Sh_006H11_contig-3_p000010

Overview
NameSh_006H11_contig-3_p000010
Unique NameSh_006H11_contig-3_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length765
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_006H11_contig-3contigSh_006H11_contig-3:10829..23017
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC2.7.1.68
InterProIPR002498
InterProIPR017163
InterProIPR003409
InterProIPR027484
InterProIPR027483
InterProIPR023610
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_006H11_contig-3_t000010Sh_006H11_contig-3_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_006H11_contig-3_p000010 ID=Sh_006H11_contig-3_p000010|Name=Sh_006H11_contig-3_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=765bp
MAETSAAQRGNTLPNGDIYVGNFAGLVPHGFGKYMWTDGTLYYGEWDTSK
MTGRGVIQWPSGASYDGDLCGGFIDGTGTFKGVDGSVYKGSWRMNKKHGM
GTMVYANGDTYEGLWNEGLPDGFGKYTWVDGNIYIGGWKSGKMNGRGVMQ
WTNGDTLDCNWLNGLAHGKGFCKYALGACYIGTWDRGLKDGHGMFYQPGS
KMPSNLEVSECVTDHDISSSSSSGNENINSGLLFLFQKLCNAWRLRSLFH
WPRRISNGTTPVFDDNSGNNLSQDSSTEPLATDNCVQDSGVDKVLVYERE
YVQGVLISEKPKCHDSGMLDSGKTQEHTWQKQSGGPMETIFKGHRSYYLM
LNLQLGIRYTVGKITPVPLREVRSNDFGPRARIRMYFPTEGSQYTPPHHS
VNFFWKDYCPMVFRNLREMFHIDAADYMMSICGDDSLKELSSPGKSGSIF
YLSQDERFVIKTLRKAELKILLKMLPKYYSHVRAYDNTLITKFFGVHRIT
LKGGRKVRFVVMGNMFCTELRIHRKYDLKGSTQGRSTKMQNINENTTLKD
LDLSYVFHVDKPWRDALFRQISLDCMFLESQSIIDYSMLLGIHFRAPYHL
KTSSSHQSSLERCGIPDSELLQYEEKSSWKGFLLVAHEPGTTVGGSHIRG
SMVRASEAGYEEVDLVLPGTGRFRVQLGVNMPARARKVHEDMNTELENPN
TIEEYDVVLYLGIIDILQEYNMSKRVEHAVKSLKFDPLSISAVDPNSYSK
RFVKFLESVFPEQD*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016307phosphatidylinositol phosphate kinase activity
GO:0005524ATP binding
GO:00163081-phosphatidylinositol-4-phosphate 5-kinase activity
Vocabulary: Biological Process
TermDefinition
GO:0046488phosphatidylinositol metabolic process