Sh_006H11_contig-3_p000050

Overview
NameSh_006H11_contig-3_p000050
Unique NameSh_006H11_contig-3_p000050
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length269
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_006H11_contig-3contigSh_006H11_contig-3:38209..39015
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR017923
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_006H11_contig-3_t000050Sh_006H11_contig-3_t000050R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_006H11_contig-3_p000050 ID=Sh_006H11_contig-3_p000050|Name=Sh_006H11_contig-3_p000050|organism=R570 Sugarcane cultivar|type=polypeptide|length=269bp
MALRRWKPFFPAFGAIDTAIEAATEGCSRDKYRQVRSDLVEMLCDCDAAD
SDDDVRAEGLCRLLDRAMAEALLTLRAVPVPVTPTMLAATDVAKAVGGLL
RHEAGWVRALARGILAQWSSSIEAEAASTEAEGAALDTLLQILCEHEVTA
SVSGCVPSGPETTLLQADSMKQAAKISDLECPKKMPPGVSIAGGDRVRNE
KTGDAKRKHPGAGGYYREGDVKRQRKVPEMVDHGPRKMEPAMKSRSRVSS
WRSTDERHFSTSPRHRRV*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus