Sh_006L22_contig-1_p000080

Overview
NameSh_006L22_contig-1_p000080
Unique NameSh_006L22_contig-1_p000080
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length317
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_006L22_contig-1contigSh_006L22_contig-1:34654..37582
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR002913
InterProIPR001356
InterProIPR023393
InterProIPR009057
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_006L22_contig-1_t000080Sh_006L22_contig-1_t000080R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_006L22_contig-1_p000080 ID=Sh_006L22_contig-1_p000080|Name=Sh_006L22_contig-1_p000080|organism=R570 Sugarcane cultivar|type=polypeptide|length=317bp
MAMVVVGGGKDRSSPGGGGAPQVDTGKYVRYTPEQVEALERVYSECPKPS
SLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQTVNRKLT
AMNKLLMEENDRLQKQVSRLVYENGYMRQQLHNPSAATTDTSCESVVTSG
QHHQQQNPAAPRPQRDANNPAGLLAIAEETLAEFLSKATGTAVDWVQMVG
MKPGPDSIGIIAVSHNCSGVAARACGLVSLEPTKVAEILKDRPSWYRDCR
CVDILHVIPTGNGGTIELIYMQTYAPTTLAAPRDFWTLRYTSGLEDGSLV
ICERSLTQSTGHYYKT*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0008289lipid binding
GO:0003677DNA binding