Sh_007H06_p000010

Overview
NameSh_007H06_p000010
Unique NameSh_007H06_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length375
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_007H06contigSh_007H06:13989..16351
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC4.1.2.48
EC4.1.2.49
InterProIPR023603
InterProIPR015424
InterProIPR015421
InterProIPR001597
InterProIPR015422
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_007H06_t000010Sh_007H06_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_007H06_p000010 ID=Sh_007H06_p000010|Name=Sh_007H06_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=375bp
MATNKVVVDLRSDTVTKPSDAMRAAMAAAEVDDDVRGADPTARRFQEAMA
AIMGKEAALFVPSGTMGNLVSVLVHCDVRGSEAILGDGSHIHLYENGGIS
TIGGVHPKTVRNNADGTMDIDRIVAAIRPPGGGLYYPTTRLICLENTQGN
SGGKCLSVEYTDKVGEIAKSHGLKLHIDGARIFNASVALGVPVDRLVKAA
DSVSVCLSKGLGAPVGSVIVGSKAFIDKAKILRKTLGGGMRQVGVLCAAA
HVAVRDTVGKLADDHRKAKTLAEGLNKIEQFTVDSASVETNMVFLDIVDS
RISSDKLCQVLGTHNVLANPRSPKSVRLVLHYQISDTDVQYALTCFKKAV
EELLMGSSELEHLADTTTKNSYGH*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003824catalytic activity
GO:0016829lyase activity
Vocabulary: Biological Process
TermDefinition
GO:0006520cellular amino acid metabolic process