Sh_007H06_p000090

Overview
NameSh_007H06_p000090
Unique NameSh_007H06_p000090
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length937
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_007H06contigSh_007H06:99855..103748
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR011991
InterProIPR001611
InterProIPR003591
InterProIPR032675
InterProIPR003593
InterProIPR027417
InterProIPR002182
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_007H06_t000090Sh_007H06_t000090R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_007H06_p000090 ID=Sh_007H06_p000090|Name=Sh_007H06_p000090|organism=R570 Sugarcane cultivar|type=polypeptide|length=937bp
MPLLNEAGHRSSATVASASDSSFACCHSPSSPMAECLEPLFGCLQSTGML
GAAGREMDAFLRIKSNWGDLEKARDSLRAVETTVRAAVMAEQDKLNVCDP
QVEVWLKRVNELRQDTIDEDYSSLLGFSCLCQCTVHARRRASIGKRVVDA
LEEVNKLTQEGKGFTTFGFKPPPRAVSRLSQTETVGLEPMLTRLHDLLEK
GESSIIGVWGQGGIGKTTLLHAFNNDLEKEDHNYQVVIFIEVSNSETLNT
VEMQQTISDRLNLPWNESETVEKRAKFLVKALARKRFLLLLDDVRKRFRL
EDVGIPTPDTKSQSKLILTSRFQEVCFQMGAQRSRIEMKVLDDDAAWKLF
LSKLSNEAFAAVQSPNFNKVVRDQAKKIFFSCGGLPLALNVIGTAVAGLE
GPREWISAANDINMLNNEDVDEMFYGLKYSYDRLKPTQQQCFLYCTLFPE
YGSISKEPLVDYWLAEGLLLNDRQKGDQIIQSLISASLLQTSSSLSSKVK
MHHVIRHMGIWLVNKTGQKFLVQAGMALDSAPPAEEWKEATRISIMSNDI
KELPFSPECESLTTLLIQNNPNLNKLSSGFFKFMPSLKVLDLSHTAITSL
PECETLVALQHLNLSHTRIRILPERLWLLKELRHLDLSVTAELEDTLNNC
SKLLKLRVLNLFRSHYGISDVNDLNLDSLNALMFLGITIYAEDVLKKLNK
TSPLAKSTFRLNLKYCRKMHSLKISDLNHLVHLEELYVESCYNLSTLDAD
AELTTSGLELLTLSVLPMLENVIVAPTPHHFRHIRKLAISSCPKLKNITW
VLKLEMLERLVITNCDGLLKIVEEDSGDEAETMLEDKCIDDGQSACNSGD
NTHAEFLNLRSIVLTDVKMLRSICKPRNFPSLETIRVEDCPNLRSIPLSS
TYNCGKLKQVCGSVDWWEKLEWEDKEGKESKFFIPI*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO:0043531ADP binding