Sh_008F07_p000070

Overview
NameSh_008F07_p000070
Unique NameSh_008F07_p000070
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length336
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_008F07contigSh_008F07:64343..69897
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR002110
InterProIPR020683
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_008F07_t000070Sh_008F07_t000070R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_008F07_p000070 ID=Sh_008F07_p000070|Name=Sh_008F07_p000070|organism=R570 Sugarcane cultivar|type=polypeptide|length=336bp
MASSGDPPGSADEKKAPKSEGSSDERQGVPPAGFSNPFDFASMQSLLNDP
SIKEMADQIAKDPAFNRMAEQLQKSAHSTGEQGMPPLDPQQYMETMQKVM
ENPQFMTMAERLGNALMQDPAMSSMLETFSSPSHKEQLEERMSRIKEDPA
MKSILDELENGGPSAMMKYWNDPDTLQKIGEAMGASFPFGAGSSAEPSAT
EETEEEGGDDDESIVHHTASVGDEEGLKKALDGGADKDEEDSEGRRALHF
ACGYGELKCAQILLEAGAAVDALDKNKNTPLHYAAGYGRKECVDLLLQHG
AAVTLQNLDGKTPIDVAKLNNQDEVLKLLEKDAFL*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding