Sh_008F07_p000080

Overview
NameSh_008F07_p000080
Unique NameSh_008F07_p000080
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length113
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_008F07contigSh_008F07:73408..74419
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR009262
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_008F07_t000080Sh_008F07_t000080R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_008F07_p000080 ID=Sh_008F07_p000080|Name=Sh_008F07_p000080|organism=R570 Sugarcane cultivar|type=polypeptide|length=113bp
MDNWCSLVLPFVGFAVAMFLFYSTVPIILKICGATMLNLSLLTSDMWAVL
IRIFAYHEKVDWIYFVAFAATAGGIVLYSYKGSNEVETAQVAGASDEHGK
DRDEEAGTQNPV*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006810transport
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane