Sh_008F07_p000100

Overview
NameSh_008F07_p000100
Unique NameSh_008F07_p000100
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length208
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_008F07contigSh_008F07:74953..76653
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR009262
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_008F07_t000100Sh_008F07_t000100R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_008F07_p000100 ID=Sh_008F07_p000100|Name=Sh_008F07_p000100|organism=R570 Sugarcane cultivar|type=polypeptide|length=208bp
MAPPDEGAAAGGARRWVRRETLLGLALGQFVSLLITATGFASSELARRGI
NAPTSQSLLNYILLAVAYGGVLLYRRQPLTIKWYYYLILGIIDVEANYIG
MYLTQIKALFQFLLVPLIFLFACAVVKSYQYTSLTSVMLLDCWSIPCVIV
LTWVFLKTKYGLRKFLGVGVCVVGLILVVFSDVHASDRASKNMLLMVLYM
CLCYSRI*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006810transport
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane