Sh_008F07_t000070

Overview
NameSh_008F07_t000070
Unique NameSh_008F07_t000070
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1008
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_008F07contigSh_008F07:63833..70150
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteAnkyrin repeat domain-containing protein 2
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_008F07_g000070Sh_008F07_g000070R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_008F07_p000070Sh_008F07_p000070R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_008F07_t000070 ID=Sh_008F07_t000070|Name=Sh_008F07_t000070|organism=R570 Sugarcane cultivar|type=mRNA|length=1008bp
ATGGCGTCGAGTGGGGATCCGCCCGGATCTGCTGATGAGAAGAAAGCTCC
AAAATCTGAAGGATCTTCTGACGAACGTCAAGGGGTTCCTCCAGCAGGCT
TTTCAAATCCTTTTGATTTTGCTTCTATGCAAAGTTTGCTCAACGATCCA
TCTATTAAGGAGATGGCAGATCAAATTGCAAAGGATCCTGCATTCAACCG
GATGGCTGAGCAGCTACAGAAAAGTGCTCATAGTACAGGCGAACAGGGCA
TGCCTCCATTGGACCCTCAACAATACATGGAAACAATGCAAAAGGTCATG
GAAAACCCCCAGTTTATGACAATGGCAGAGCGCCTGGGGAATGCTCTTAT
GCAGGATCCTGCTATGTCCAGTATGCTAGAAACCTTTAGTAGTCCATCAC
ATAAGGAGCAGCTGGAAGAGCGTATGTCTCGCATTAAGGAAGATCCAGCA
ATGAAGTCAATTCTTGACGAATTAGAGAATGGGGGTCCTTCTGCAATGAT
GAAGTACTGGAACGACCCTGATACTCTTCAAAAGATTGGCGAAGCAATGG
GAGCTAGCTTCCCATTTGGTGCAGGTTCTTCTGCTGAACCTTCTGCTACT
GAAGAAACTGAGGAAGAAGGTGGGGATGATGATGAATCCATCGTCCATCA
CACTGCCAGCGTTGGTGATGAAGAGGGTCTCAAGAAGGCACTAGACGGTG
GAGCAGACAAGGATGAAGAAGACTCTGAGGGAAGAAGGGCCTTACATTTT
GCATGTGGGTATGGTGAGTTGAAGTGTGCCCAGATCCTTCTTGAGGCTGG
TGCTGCAGTGGACGCTTTGGACAAGAATAAGAACACCCCACTGCATTATG
CCGCTGGCTATGGCAGGAAGGAGTGTGTGGATCTTCTTTTGCAGCATGGT
GCTGCCGTAACGCTCCAAAACCTGGATGGGAAGACACCTATCGACGTTGC
CAAGCTCAATAACCAGGACGAGGTTCTCAAGTTGCTCGAGAAGGACGCCT
TCCTTTAA
back to top

protein sequence of Sh_008F07_p000070

>Sh_008F07_p000070 ID=Sh_008F07_p000070|Name=Sh_008F07_p000070|organism=R570 Sugarcane cultivar|type=polypeptide|length=336bp
MASSGDPPGSADEKKAPKSEGSSDERQGVPPAGFSNPFDFASMQSLLNDP
SIKEMADQIAKDPAFNRMAEQLQKSAHSTGEQGMPPLDPQQYMETMQKVM
ENPQFMTMAERLGNALMQDPAMSSMLETFSSPSHKEQLEERMSRIKEDPA
MKSILDELENGGPSAMMKYWNDPDTLQKIGEAMGASFPFGAGSSAEPSAT
EETEEEGGDDDESIVHHTASVGDEEGLKKALDGGADKDEEDSEGRRALHF
ACGYGELKCAQILLEAGAAVDALDKNKNTPLHYAAGYGRKECVDLLLQHG
AAVTLQNLDGKTPIDVAKLNNQDEVLKLLEKDAFL*
back to top

mRNA from alignment at Sh_008F07:63833..70150+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_008F07_t000070 ID=Sh_008F07_t000070|Name=Sh_008F07_t000070|organism=R570 Sugarcane cultivar|type=mRNA|length=6318bp|location=Sequence derived from alignment at Sh_008F07:63833..70150+ (R570 Sugarcane cultivar)
GTGTCGTGCCTTCGTCTCGTCCGTCCCCTAGTCCCTACGAGTAGGGATGA AAACGGATAAGATATGGACGGATATGACTGATATCGTATTTGTTTTCATA TTTATGTCTGGATTCGGATTCGAATACGGATAGTATAAAAAATATCGGAT AAGATACGATTGGATATCGACATCATAAATATGTGATTTAAATATTCGAA TACGAATACGATATCGGATGTTAAATATCTGGACTCGGATACGGACGGAT TAAAACCCCTCTAAACGGATTCGGTATCGAATACGGTCGGAAAATATCCG CACTGTTTTCATCCCTACCTACGAGGCTACGACCCTACTCCCTCGCGCAC GCCACCGTCCAGCAGCGCCGCCGCGGGGCGAGGCCGAACCCTCCTCCGTT CGCCGAGGCGGAGCACGCCCTTCCGGACCAGCTTCCACCGGGGCAAGCGC TAAGTCGCCTCGAATTCTTCCCTGCTACTAGCGGGCGCCCTCCTCCGTTG CTCTACCGGGATGGCGTCGAGTGGGGATCCGCCCGGATCTGCTGGTGAGC GCTCTCTCGCTCGCTCGCTTGATTGGATTGTGTTTTACTCTGTTCCGATC TTCGCTGTGCTCGGAGAATCGAATCGAGTCCGCGTCTTCCTCTGTGGATC GTCCTGCTGCAGTTCATCCAGTCAGTTGTGGATTTATTTGCTGTGTCTGG TAGAGTGCTAATCCAATCCGTTCGTCCATGGCTCGATTCGGACCCCGCGC GAGCTCGATCTTAGTGTTAGGGTGCTTGTTATGCTGAATTACTGATGCTG ATAGCAGTTTATCTGCTGAAAATCGGGGGATCAGTAGTACCCTCACGCCC TAGTGAAGTCCGCCTCTGCACGCAAGGGATGTCAGTGATACGAATTTTGT AGCAACAGAGTTTTTTTTTTGCAATTGTTCGATGAGAATTTGCTAATTCA TTTGGCTGCCCACTGATGAGTCACAGTAGGAAAAATAAGTGGCCTATTCA ACTCAATTGGTTAATTACATTCCTTGTGTGTTAGGGTTGTGCGGGGGATT CTAGGTTTTAGGGGGTGTCAGTAATTTGGTCTGCCTTTTCTTTTTTATAT ATAGGTAGTTTAAACTTCCATTCTATTAAGTTGAAAATAAATAAGTTCAA TGATAGCCATGTTGTCTCAACTATGCATTGCATATTTATGAACTCACCAA ACTGTTGTCAGTTTCTTTCAATGGCCGTTTCATTTTGCTTTGCTGTCATA GTTTGTTACCACATGATGTCTGTTTTTGTTCTTATCCTTTTCTTTTGCAG ATGAGAAGAAAGCTCCAAAATCTGAAGGATCTTCTGACGAACGTCAAGGG GTTCCTCCAGCAGGCTTTTCAAATCCTTTTGATTTTGCTTCTATGCAAAG TTTGCTCAACGTATGCCCCTCTATGGCCATATAAATCCTGTAGTACATAC TGATCTTCCTAATTACTTTTACAGGATGGTGTTGTTCACTTAGTATCAAT ACATTATTGTAGTTTTACATGCTTGCATTCTTCTAGCTTTATCTGAATCG GCATTATTTTTATTTAATGGACTCTTTGCAGATTGCTTCAACGTTTACCC TTGTTATGCGCAGGATCCATCTATTAAGGAGATGGCAGATCAAATTGCAA AGGATCCTGCATTCAACCGGATGGCTGAGCAGCTACAGAAAAGTGCTCAT AGTACAGGCGAACAGGGCATGCCTCCATTGGACCCTCAACAATACATGGA AACAATGCAAAAGGTCATGGAAAACCCCCAGTTTATGACAATGGCAGAGC GCCTGGGGAATGCTCTTATGCAGGTACCATTGGAAAAACCCCGGCTGGTT TCCATTGCCTTATTTGTCTATCAGTGCCCTAAGTCTCAGTTATTTGGCTC AGGATCCTGCTATGTCCAGTATGCTAGAAACCTTTAGTAGTCCATCACAT AAGGAGCAGCTGGAAGAGCGTATGTCTCGCATTAAGGAAGATCCAGCAAT GAAGTCAATTCTTGACGAATTAGAGAATGGGGGTCCTTCTGCAATGATGA AGTAGGTCATATCTACTACAGATATGTTTTGTTTATAGAGTTTGTTTGTG ACATTCCTTCCTGTCCTCCTCTAGGTACTGGAACGACCCTGATACTCTTC AAAAGATTGGCGAAGCAATGGGAGCTAGCTTCCCATTTGGTGCAGGTTCT TCTGCTGAACCTTCTGCTACTGAAGAAACTGAGGAAGAAGGTGGGGATGA TGATGAATCCATCGTCCATCACACTGCCAGCGTTGGTGATGAAGAGGTAA TGAGAACATTGGTTTGAATGTTCGGTTTTAAATTTTTGTATTGAGTTGTT TTGGACTTTGCATATATTTTTATATTATATATGCTGGTGACACTACAAAT CTACTTCATCAATGCCCATTACTACCTTTTGGTGTTTGCCGTATATCTAT TTAATCTGAGTGATGCCACTGGAACATAGGAATTTTGTGGCTGTCATTGT CATGTTGGTGTTTTTAGGTTAGATGTTTCTTGTAGCTATTATAATCATGT GGATGTTTTCAAATAAGATGAACTTGCTTACATTGCTATCTTGAGACATT AGGGCAGACTAGTTAACCCCTAGTCATCGACTTTCTGATTCTCAGAAATT CACTAGACGAATATATGCGATTTGTGCACCAAGCCACCAACCACTGCATC TTTCTGCTTATCAGTCATTCGTGATTTTTGCTCTTAAATCGCCTTTATGG CCATGGACTCATATTTGAACCTGCAATATTATGTTCAGTGTTCATGTTAT GGACGTCGTTGGGATGGGGAGAATTGAGGAGGAAGAGAGGAGCGGCGATG AGCTACAGTACCCACGCGGGTACTGTTCATACAAGAGTGGCAGAGGACCG GCGGCTAGAGCTGTCAGGGGCGCTGGGAACGCCGGCCGCAGGGCTTCGCC CACGGCCGGCAAGAGAGAAGGTTTTTCCTTCTAATCTCTTGCTTGATTAG ATCGATACATCTCCTCCTTATATAGAGAAGATGTCTTACTTGACCCCTAA GCAAGCGACTAATTAACCCTAACGGGCTAAGGCCCAATAGGCCCTTGACT CTTCTAACACTACACCCCACCTGGATATGCAGCTCGTCCTCGAGCTGCAA CTTAGCGATGACTCTGCTAGACACAAACTTAACACCTAAAAATAAGCCTT TTACATCTCGGCTTATTTTATTGACCTGAAATAGACTACGACTCTTTATT TTTGACTCCTGAAGATACGGCGGACACCCTCTGCGTGATGGACCTGCACG TGTGTAGCCACCTGGATCCCATGGAGCCCACTGAAACGAGAGGGGTGCAT GGGTATAGCCACCTGGAATTAGTCGCGATAGCGACCAGCGGAGACGTCCT CGCGGCGGCCGGCGGCGGAATGCGGTGGCGCGAGGCAATGCGTCCCCGCC GGTGACAAGGAGGGGAGCGACTCCCCTACCGCAGAGTTGGAGGTCGTTGC GCGCGGGAAAAACACCATGCTCGCACCTGAAGACAACAGCGGGTCGGCAC GGTTGCTGGTGGCCGTCCCACGGGGCGAGGTCGCGCTTCGCTGAGCTGAG GTCGACTGTCGCCAAAGTCGCCTCGTGCATAGGCTGGCGCATCTCCTGCA GCCGCCGGCGCGCTAGGAGGCCGCGCGCCGCAGCCTGTAGCCGCACCGCC GCAGACACCTTGCAGGTAAACATCTTCCCTGCCGGCTCCGTCATGATGTC CATCGCCTGCTCGATCTGCTGCATTGTTGGCTGCACCGTTGGCTGCACGT CCTGGAACGGTAGCAGCGTCGTGCTATAACCTGGCATCCCGTAGGGGAAA ACCGGTGGCAGAGAGGCCACGGCCGATTGCGGCAGCGACCAGCTGGCTGG TTGCAGCGGCGATATGCCGAGGTAGGACTGGATGGCGGCGACGGAACGGG CGAGATCGGTGATGGCCGCGGTCAATTGATCCGGTGTCATCGGTGAGGAA GTGACCGGCGACGGCTCATCGTAACCTGGCATCTCCGATACCAGATTGTT ATGGTTGAGAGGGGGGAGAGGCGCGAGTAGACGTCGTTGGGATTGGGAGA AGAGAGTCGAGAGGAGCGGCGGCGAGCTACAGTACCCGTGCGGGTACTGT TCATGCGAGAGCGGCAGAGGACCGGCGGCTAGAGCTGTCAGGGACGCTGG GAACGCCGGCCGCAGGGCTTCGCCCACGGCCGGCAAGAGAGAAGGTTTTT CCTTCTAATCTCTTGCTTGATTAGATCGATACATCTCCTATTCTTATATA GAGAAGAGGTCTTACTTGACCCATAAGCAAGCGACTAATTAACCCTAACG GGCTAAGGCCCAATAGGCCCTTGACTCTTCTAACAGTTCACATGGTCATA AATTGATGTATGGTTTATAAATAATCTTGATAAGTCATCAACATTGCATG TTTTGTTCGAAACATCAATTTATCTGTCTTCACAGTTAATACAGTTACCA CCTTGCTACTGGGTTTTGATTTTGATATGCTGATGCCGCCTTCTAAAATT CATGCAATAGGGTCTCAAGAAGGCACTAGACGGTGGAGCAGACAAGGATG AAGAAGACTCTGAGGGAAGAAGGGCCTTACATTTTGCATGTGGGTATGGT GAGGTATGCAGATCTCCTCAGCCTTGTTAATACGTGGTAAATTCGAACTT GTGGAACTAATGAATGTCCAATGATACCAACACTTCAACATTGTTTGTCA TACTACCACATGACTAGGCAAGCTATGAACAAAATTATATTTAATTTGCA AGGCACATGGGATATCCGTTTTCCTAAAGTCTTCAAAAACTTTTAGGGCC TGGATGACATAGTATTAGAAAACTGTGGTTTTGTGAGCCAAAGACGCAAA ACCATGGTTTAGAAAAAAAGAGGTCGTGAGTGGAGTTTCTAGAACTTCAA AAAGACCACGGTTTTGATAAAACCATTAACCATGGTCTTAGAAACATGTA GGTTGTTGTATCCAAACACCCAACAGATTTCGAAAACCAAAATATTTTGC AGAACCATAGTATTTATCGGATACTCCAAAATTGCTTTGCATCCAAACGA GGTCTTAATTCTTTTGGTGTTTTTAAAACATGTGGCAGTTTTCTAATTAC TGTTCGGAAACTAGCCAGCTCTTGAATATTTAGCTTGTTTAGAGTCTAAA AGACTTACTTTTCAACTATGATAAAATCTAACTGAACATAGGAGGTTTCT TAATAATTTTATGAAAAATGAAGGTATCACCTTGGAGCCCCTAGCATTGC TTTAAATTTGGTGGGACTGCCAAGACATACCGATTACCTCATATTAGGTG CCTACAAAACACTTCCTTGGACCGGTGGCGGCCTGGGCTGTTTTTTGATA CACAGGTGGCCATTAGCTTTCTAGGAGTTGGTAATGGTTCGCTTTCTAAC CTTGAGATAATTGTTTTGGTATTCAGAGTAGTTTTCAGGACCTTGCTGTT GAGTAATTGCAATTTGTGGTCTTTGGGATTGGCATTATAGTCCTTTGAAG GTTGTATTGATGCTGGAACATTTAAATCTAGTAGTGATCTTATGCTGTTG TGATTTCATAGGTATAGTAGAATCTAGAACGTTAGGTGGTAAAATTTATT TGGGGAATGGGAAATGAGTACATTTGTTTCCATATTTGTTACATCTGTTT GTATCTTTATTGATACTAGTTTTAAAGAATTTGGTGAACTCCATTTCAGT TGAAGTGTGCCCAGATCCTTCTTGAGGCTGGTGCTGCAGTGGACGCTTTG GACAAGAATAAGAACACCCCACTGCATTATGCCGCTGGCTATGGCAGGAA GGAGTGTGTGGATCTTCTTTTGCAGCATGGTGCTGCCGTGTAAGTTAAAT CATCTCTTTCCTTTCCCAAGGGTGATATCATCGATGTTGCTTTGACCGTC TCCAATGTACTGCAGAACGCTCCAAAACCTGGATGGGAAGACACCTATCG ACGTTGCCAAGCTCAATAACCAGGACGAGGTTCTCAAGTTGCTCGAGAAG GACGCCTTCCTTTAAATATCATGGCTTCCATAGACACGTGGACTCTTGGT TCAAGTATGGTCATGTTTCATGTTTTTGTTTGGATAGCCACATATCGGGG CCTTGTATCTGTTTTATGCCTAATTGCTATCTGGTCTAGCTAGCATGCGG GTCATGCTACAGTTAAGAGGCTGCTGTTTGAACAACCTGTAATGGTCTGC CGTACGTGACTTGTGTATTCCCACTTCATTTCTGATATTGAAGCTCATGC ATGTTTCCGGCCTTCCGG
back to top

Coding sequence (CDS) from alignment at Sh_008F07:63833..70150+

>Sh_008F07_t000070 ID=Sh_008F07_t000070|Name=Sh_008F07_t000070|organism=R570 Sugarcane cultivar|type=CDS|length=1008bp|location=Sequence derived from alignment at Sh_008F07:63833..70150+ (R570 Sugarcane cultivar)
ATGGCGTCGAGTGGGGATCCGCCCGGATCTGCTGATGAGAAGAAAGCTCC
AAAATCTGAAGGATCTTCTGACGAACGTCAAGGGGTTCCTCCAGCAGGCT
TTTCAAATCCTTTTGATTTTGCTTCTATGCAAAGTTTGCTCAACGATCCA
TCTATTAAGGAGATGGCAGATCAAATTGCAAAGGATCCTGCATTCAACCG
GATGGCTGAGCAGCTACAGAAAAGTGCTCATAGTACAGGCGAACAGGGCA
TGCCTCCATTGGACCCTCAACAATACATGGAAACAATGCAAAAGGTCATG
GAAAACCCCCAGTTTATGACAATGGCAGAGCGCCTGGGGAATGCTCTTAT
GCAGGATCCTGCTATGTCCAGTATGCTAGAAACCTTTAGTAGTCCATCAC
ATAAGGAGCAGCTGGAAGAGCGTATGTCTCGCATTAAGGAAGATCCAGCA
ATGAAGTCAATTCTTGACGAATTAGAGAATGGGGGTCCTTCTGCAATGAT
GAAGTACTGGAACGACCCTGATACTCTTCAAAAGATTGGCGAAGCAATGG
GAGCTAGCTTCCCATTTGGTGCAGGTTCTTCTGCTGAACCTTCTGCTACT
GAAGAAACTGAGGAAGAAGGTGGGGATGATGATGAATCCATCGTCCATCA
CACTGCCAGCGTTGGTGATGAAGAGGGTCTCAAGAAGGCACTAGACGGTG
GAGCAGACAAGGATGAAGAAGACTCTGAGGGAAGAAGGGCCTTACATTTT
GCATGTGGGTATGGTGAGTTGAAGTGTGCCCAGATCCTTCTTGAGGCTGG
TGCTGCAGTGGACGCTTTGGACAAGAATAAGAACACCCCACTGCATTATG
CCGCTGGCTATGGCAGGAAGGAGTGTGTGGATCTTCTTTTGCAGCATGGT
GCTGCCGTAACGCTCCAAAACCTGGATGGGAAGACACCTATCGACGTTGC
CAAGCTCAATAACCAGGACGAGGTTCTCAAGTTGCTCGAGAAGGACGCCT
TCCTTTAA
back to top