Sh_008F19_p000010

Overview
NameSh_008F19_p000010
Unique NameSh_008F19_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length310
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_008F19contigSh_008F19:9578..10660
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR003657
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_008F19_t000010Sh_008F19_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_008F19_p000010 ID=Sh_008F19_p000010|Name=Sh_008F19_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=310bp
MDGEWSGGAAASTPTVSGGESKAGPAGGVSSSADCPGSPVSPVPPSTSPA
AATGTGRRRSANKRVVTVPLADVSGPRPKGVGEGNTPTDSWAWRKYGQKP
IKGSPFPRAYYRCSSSKGCPARKQVERSWAEPDKVIVTYSFEHSHSDAVA
RAQNRSAPKPKAAQLPVPAPEPAAESPSSGSHDVAAATAVCGGTPAAAAE
TEVVGAAAAVEVHDEFRWLYDGVSVTSSASPSDVEAADEMLYGAMSFFGA
AAPPAAPLPDEFGDVGGLFDYGEGGEEDAMFAGLGELPECAMVFRRHAGD
GLPVASGVK*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated