Sh_008F19_p000030

Overview
NameSh_008F19_p000030
Unique NameSh_008F19_p000030
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1070
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_008F19contigSh_008F19:18972..24516
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR008921
InterProIPR027417
InterProIPR022754
InterProIPR012763
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_008F19_t000030Sh_008F19_t000030R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_008F19_p000030 ID=Sh_008F19_p000030|Name=Sh_008F19_p000030|organism=R570 Sugarcane cultivar|type=polypeptide|length=1070bp
MPAPDRAAAGGGAGGHLRGHAHLTNCIHLRHHHGHAHGGAGAGGATSSGR
RRSPASVASASLMRDLLALQRSRSLRDPSTRRSVESSRVAADPDAYADTE
DDVDLPAVTTSRRSAGALKTLLDQLAENPHPHPKPGRRPPRRFKRRAGRR
ATAGSKPPDRAAALSVNSSSQEAVCGNIYLFHGDDDDDGGEELQQHLPQD
SRNVCGIPWNWSRLHHRGKSILDMAGRSLSCGLSDSKSAAGRKSEEAAAS
GGRVNASRPLFPVKSERLASSTSSDSDALPLLVEAATSSARNRIGAISGS
YSGELGIFSNQTSEMDSDLLSESQSGQKSQASQHGRGRHRSLTQKFAPKT
FKDVVGQSLVVQALSNAILRRKIGLVYVFYGPHGTGKTSCARVFAKALNC
LSSEHPRPCDSCTSCIAHNLGKSRGLMEIGPVGNIDMDCIVDVLDNVMLS
PAPSHYRVFIFDDCDTLPADTWSAISKVVDRAPRRVVFILVCPNLELPHI
ILSRCQKFFFPKLRESDIVNTLQWICTSESLDVDKDALKLIASRSDGSLR
DAEMTLDQLSLLGQRISLSLVQELVGLVSDDKLVDLLDLALSADTVNTVK
TLRDITETGVEPLALMSQLATIITDILAGSYAFTRERPRRKFFKRPTLSK
EDMEKLRQALKTLSEAEKQLRVSSDKTTWLTAALLQLAPDKQYLLPSSST
STSLNHGVLVGSFPDRGIGRASAVEHKGNLASTSYGERRTVEHTENGHVL
STSSVRANEGTKHRKAENEMIWQAVLESIQSDTLRKMMAKEARLNSVSLG
TAPTAQLIFSSHINKSKAENYRAQILQAFESVLRSAIILEIRYESKNDAK
AGHASSMSPYPGNDSSNATLRRTFTKHSPLSYGGENLITRLKKDSVVKGA
NSSKTRWMQSDPHILTEGEIIEVGPSHMHWHAQTNNGALDINERRKENVW
EEEALASPNQESMTNRKGRNGNIQRRQNNIVKGKVSLAHVIGRAEACSQR
GGWTRRKAISIAEKLEQENLRLEPKSSLLCWRTSRTRRKLSSIKVRNRRS
RPISRLILCGRCISTKSPR*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003677DNA binding
GO:0003887DNA-directed DNA polymerase activity
GO:0005524ATP binding
Vocabulary: Biological Process
TermDefinition
GO:0006260DNA replication
Vocabulary: Cellular Component
TermDefinition
GO:0009360DNA polymerase III complex