Sh_008F19_t000010

Overview
NameSh_008F19_t000010
Unique NameSh_008F19_t000010
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length930
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_008F19contigSh_008F19:9578..11307
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteWRKY transcription factor
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_008F19_g000010Sh_008F19_g000010R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_008F19_p000010Sh_008F19_p000010R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_008F19_t000010 ID=Sh_008F19_t000010|Name=Sh_008F19_t000010|organism=R570 Sugarcane cultivar|type=mRNA|length=930bp
ATGGACGGCGAGTGGAGCGGCGGGGCGGCGGCGTCCACGCCGACGGTGTC
CGGCGGTGAGAGCAAGGCTGGCCCTGCTGGTGGCGTTTCGTCGTCGGCTG
ATTGCCCAGGGTCGCCGGTGTCGCCTGTGCCACCGTCGACGTCGCCAGCT
GCTGCCACCGGTACCGGGAGGAGGCGGTCGGCGAACAAGCGGGTGGTGAC
CGTGCCGCTGGCCGACGTCAGCGGCCCTCGGCCCAAGGGCGTCGGCGAGG
GCAACACGCCGACGGACTCGTGGGCGTGGCGGAAGTACGGCCAGAAGCCC
ATCAAGGGCTCGCCTTTTCCGAGGGCTTATTACAGGTGCAGCAGTTCCAA
GGGGTGCCCGGCGAGGAAGCAGGTGGAACGGAGCTGGGCCGAGCCGGACA
AGGTGATCGTCACGTACTCGTTCGAGCACAGCCACTCCGACGCCGTGGCA
AGGGCGCAGAACCGCTCGGCCCCGAAGCCAAAGGCGGCCCAGCTGCCAGT
CCCGGCGCCAGAGCCGGCGGCGGAGTCCCCGTCATCCGGCAGCCACGACG
TCGCCGCTGCCACGGCGGTTTGCGGCGGCACTCCTGCTGCTGCAGCCGAA
ACCGAGGTCGTTGGCGCGGCGGCCGCCGTCGAGGTGCACGACGAGTTCAG
GTGGCTCTACGACGGCGTGTCCGTCACCTCCTCGGCGTCTCCCTCGGACG
TCGAGGCGGCGGACGAGATGCTGTACGGGGCGATGTCGTTCTTCGGCGCC
GCCGCCCCGCCCGCCGCGCCCCTCCCCGACGAGTTCGGCGACGTCGGCGG
GCTGTTCGACTACGGGGAAGGGGGCGAGGAGGACGCCATGTTCGCGGGCC
TCGGCGAGCTGCCCGAGTGCGCCATGGTGTTTCGGCGGCACGCCGGCGAC
GGGCTTCCGGTGGCGAGCGGGGTGAAGTGA
back to top

protein sequence of Sh_008F19_p000010

>Sh_008F19_p000010 ID=Sh_008F19_p000010|Name=Sh_008F19_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=310bp
MDGEWSGGAAASTPTVSGGESKAGPAGGVSSSADCPGSPVSPVPPSTSPA
AATGTGRRRSANKRVVTVPLADVSGPRPKGVGEGNTPTDSWAWRKYGQKP
IKGSPFPRAYYRCSSSKGCPARKQVERSWAEPDKVIVTYSFEHSHSDAVA
RAQNRSAPKPKAAQLPVPAPEPAAESPSSGSHDVAAATAVCGGTPAAAAE
TEVVGAAAAVEVHDEFRWLYDGVSVTSSASPSDVEAADEMLYGAMSFFGA
AAPPAAPLPDEFGDVGGLFDYGEGGEEDAMFAGLGELPECAMVFRRHAGD
GLPVASGVK*
back to top

mRNA from alignment at Sh_008F19:9578..11307-

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_008F19_t000010 ID=Sh_008F19_t000010|Name=Sh_008F19_t000010|organism=R570 Sugarcane cultivar|type=mRNA|length=1730bp|location=Sequence derived from alignment at Sh_008F19:9578..11307- (R570 Sugarcane cultivar)
CCGAAGCTGCTGCTGATTTCTTCCTCGGTTCGAAACCACGCTCGTCTGCT ATTCCGCACCAACCACTCCAATGCATAATATGCGTACGATGATTAATTAA TAAGACAACTAATACTGCTTCTCGTCTAATTCCAGATCGATCCAAGGAAT AAGCAAAGCAACCGCTGACAGATGAGGGACGATGATCGATCATCAAGACG GACATGGGGATAGATAGTTGGGGAGACGTCGCCGTCGCACGCTCGCGCTC GTCTTCTCAAGCAGCTTAAGTTCCCCGCCGCGGTCTCGAAGCCTGCCTAG CTCAGCCAGCGTGCGCGCCCACAAAAACCCACGTCCTCCCCGCCAATCAC ACCGCACGAACCGAGGACGCGACACCGTCCGTCACCGCGGCGTACGTAGC CTCCCTCGATCGTGGTACTAGTTTAGCCAGCTCACTTCCACACCGCACCG CCGTTGCGTTTCTTTATATCCCGCGGAGGATGCGCCTGCCTCGGGGCAGC TGGTGACATCGGATTCGGATCAGGCCGAGAGCCCGAGAACTGCTCCGGCA AACCTGCCGCGCCCCGGCCGTTGTCTTGTCTGTCGTCTCCACTCCAGTCG ATCACGCCGCGCGCGCGCTTTCTTCCTCTCTGGGGCTGGCCAGGCAAATG GACGGCGAGTGGAGCGGCGGGGCGGCGGCGTCCACGCCGACGGTGTCCGG CGGTGAGAGCAAGGCTGGCCCTGCTGGTGGCGTTTCGTCGTCGGCTGATT GCCCAGGGTCGCCGGTGTCGCCTGTGCCACCGTCGACGTCGCCAGCTGCT GCCACCGGTACCGGGAGGAGGCGGTCGGCGAACAAGCGGGTGGTGACCGT GCCGCTGGCCGACGTCAGCGGCCCTCGGCCCAAGGGCGTCGGCGAGGGCA ACACGCCGACGGACTCGTGGGCGTGGCGGAAGTACGGCCAGAAGCCCATC AAGGGCTCGCCTTTTCCGAGGTACACGACACGTTCTAGATAGAAGCAATC AATCATGCATCCATGGTTTACATGGCCGCCCCGTGTTCTTCGAGTTCTTG TGGATGCATCACTGCCCCTAGATTTCTGTAGAGTTTTGCTGATCTGGGTT TCGGTTTTGGCGTGCGGGGGCAGGGCTTATTACAGGTGCAGCAGTTCCAA GGGGTGCCCGGCGAGGAAGCAGGTGGAACGGAGCTGGGCCGAGCCGGACA AGGTGATCGTCACGTACTCGTTCGAGCACAGCCACTCCGACGCCGTGGCA AGGGCGCAGAACCGCTCGGCCCCGAAGCCAAAGGCGGCCCAGCTGCCAGT CCCGGCGCCAGAGCCGGCGGCGGAGTCCCCGTCATCCGGCAGCCACGACG TCGCCGCTGCCACGGCGGTTTGCGGCGGCACTCCTGCTGCTGCAGCCGAA ACCGAGGTCGTTGGCGCGGCGGCCGCCGTCGAGGTGCACGACGAGTTCAG GTGGCTCTACGACGGCGTGTCCGTCACCTCCTCGGCGTCTCCCTCGGACG TCGAGGCGGCGGACGAGATGCTGTACGGGGCGATGTCGTTCTTCGGCGCC GCCGCCCCGCCCGCCGCGCCCCTCCCCGACGAGTTCGGCGACGTCGGCGG GCTGTTCGACTACGGGGAAGGGGGCGAGGAGGACGCCATGTTCGCGGGCC TCGGCGAGCTGCCCGAGTGCGCCATGGTGTTTCGGCGGCACGCCGGCGAC GGGCTTCCGGTGGCGAGCGGGGTGAAGTGA
back to top

Coding sequence (CDS) from alignment at Sh_008F19:9578..11307-

>Sh_008F19_t000010 ID=Sh_008F19_t000010|Name=Sh_008F19_t000010|organism=R570 Sugarcane cultivar|type=CDS|length=930bp|location=Sequence derived from alignment at Sh_008F19:9578..11307- (R570 Sugarcane cultivar)
ATGGACGGCGAGTGGAGCGGCGGGGCGGCGGCGTCCACGCCGACGGTGTC
CGGCGGTGAGAGCAAGGCTGGCCCTGCTGGTGGCGTTTCGTCGTCGGCTG
ATTGCCCAGGGTCGCCGGTGTCGCCTGTGCCACCGTCGACGTCGCCAGCT
GCTGCCACCGGTACCGGGAGGAGGCGGTCGGCGAACAAGCGGGTGGTGAC
CGTGCCGCTGGCCGACGTCAGCGGCCCTCGGCCCAAGGGCGTCGGCGAGG
GCAACACGCCGACGGACTCGTGGGCGTGGCGGAAGTACGGCCAGAAGCCC
ATCAAGGGCTCGCCTTTTCCGAGGGCTTATTACAGGTGCAGCAGTTCCAA
GGGGTGCCCGGCGAGGAAGCAGGTGGAACGGAGCTGGGCCGAGCCGGACA
AGGTGATCGTCACGTACTCGTTCGAGCACAGCCACTCCGACGCCGTGGCA
AGGGCGCAGAACCGCTCGGCCCCGAAGCCAAAGGCGGCCCAGCTGCCAGT
CCCGGCGCCAGAGCCGGCGGCGGAGTCCCCGTCATCCGGCAGCCACGACG
TCGCCGCTGCCACGGCGGTTTGCGGCGGCACTCCTGCTGCTGCAGCCGAA
ACCGAGGTCGTTGGCGCGGCGGCCGCCGTCGAGGTGCACGACGAGTTCAG
GTGGCTCTACGACGGCGTGTCCGTCACCTCCTCGGCGTCTCCCTCGGACG
TCGAGGCGGCGGACGAGATGCTGTACGGGGCGATGTCGTTCTTCGGCGCC
GCCGCCCCGCCCGCCGCGCCCCTCCCCGACGAGTTCGGCGACGTCGGCGG
GCTGTTCGACTACGGGGAAGGGGGCGAGGAGGACGCCATGTTCGCGGGCC
TCGGCGAGCTGCCCGAGTGCGCCATGGTGTTTCGGCGGCACGCCGGCGAC
GGGCTTCCGGTGGCGAGCGGGGTGAAGTGA
back to top