Sh_008F19_t000030

Overview
NameSh_008F19_t000030
Unique NameSh_008F19_t000030
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length3210
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_008F19contigSh_008F19:18725..24516
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteProtein STICHEL-like 3
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_008F19_g000030Sh_008F19_g000030R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_008F19_p000030Sh_008F19_p000030R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_008F19_t000030 ID=Sh_008F19_t000030|Name=Sh_008F19_t000030|organism=R570 Sugarcane cultivar|type=mRNA|length=3210bp
ATGCCGGCGCCCGACCGTGCCGCGGCGGGGGGCGGTGCCGGGGGCCACCT
CCGCGGCCACGCGCACCTCACCAACTGCATCCACCTCCGCCACCACCACG
GGCACGCGCACGGGGGAGCGGGAGCGGGAGGCGCGACGTCGTCGGGCCGG
AGGCGGAGCCCGGCGTCCGTGGCGTCCGCGTCGCTGATGCGCGACCTTCT
CGCGCTGCAGCGCTCGCGATCGCTGCGGGACCCGTCCACGCGCCGCTCCG
TCGAGTCGTCCAGGGTGGCGGCCGACCCCGACGCCTACGCCGACACCGAG
GACGACGTCGATCTCCCCGCCGTCACCACGTCCCGCCGGAGCGCCGGGGC
GCTCAAGACGCTCCTGGACCAGCTCGCCGAGAACCCCCACCCCCACCCGA
AACCGGGCCGACGCCCGCCCCGCCGGTTCAAACGCCGGGCCGGCCGCCGC
GCCACCGCTGGCAGTAAGCCTCCGGACCGCGCGGCCGCGCTCTCCGTCAA
CTCCAGCTCCCAGGAGGCCGTCTGCGGCAACATATACCTGTTCCATGGCG
ACGACGACGACGATGGCGGGGAGGAGCTGCAGCAGCATTTGCCGCAGGAC
TCGCGCAACGTCTGTGGCATTCCATGGAACTGGTCGCGTCTGCACCACCG
CGGCAAGTCCATCCTCGACATGGCCGGCCGCAGCCTTTCGTGCGGCCTCT
CCGACTCCAAGTCGGCGGCGGGGCGAAAGTCTGAAGAAGCCGCCGCCTCG
GGTGGCCGTGTCAATGCCTCGCGTCCCCTTTTCCCTGTTAAGTCCGAGAG
GCTGGCCTCGTCGACCAGCTCGGACTCGGACGCGCTGCCCCTGCTGGTTG
AGGCTGCCACCTCCAGTGCTCGGAACCGCATTGGCGCCATCTCTGGAAGC
TACTCTGGAGAGCTTGGGATTTTCTCTAACCAGACCAGCGAGATGGACTC
GGACCTGCTGTCTGAGTCTCAGTCAGGGCAGAAGTCACAGGCCTCGCAGC
ATGGCCGTGGGCGTCACCGTAGTCTGACACAGAAATTCGCACCAAAGACG
TTCAAAGACGTTGTTGGGCAGAGCTTGGTGGTGCAGGCGCTGTCCAATGC
CATCCTGAGGAGGAAGATTGGGTTGGTGTATGTGTTCTATGGGCCGCACG
GCACGGGCAAGACCTCATGTGCCCGTGTCTTCGCCAAGGCGCTCAATTGC
CTCTCCTCTGAGCACCCCAGGCCCTGTGACTCGTGCACGTCGTGCATCGC
TCACAATCTTGGCAAGAGCAGAGGCCTGATGGAGATTGGGCCTGTTGGCA
ACATCGACATGGATTGCATTGTGGACGTCCTCGATAATGTGATGCTTTCA
CCAGCACCATCACACTACAGGGTGTTTATATTTGATGACTGTGATACTCT
GCCAGCTGACACTTGGAGTGCTATCTCTAAAGTTGTGGACCGGGCACCCC
GTCGCGTTGTGTTTATCCTTGTCTGTCCAAACCTTGAACTTCCTCATATC
ATCCTGTCCAGATGCCAGAAGTTCTTTTTCCCAAAGCTGAGGGAGTCCGA
CATTGTCAATACATTGCAGTGGATTTGCACCAGCGAGAGTCTAGATGTTG
ATAAAGATGCACTGAAGCTAATTGCATCCCGTTCTGATGGATCTTTGAGG
GATGCCGAGATGACTCTTGATCAACTCAGTTTGCTGGGACAAAGGATTTC
CTTGTCTCTTGTCCAAGAATTGGTTGGCCTGGTGTCTGATGATAAACTGG
TTGATTTGCTTGATTTGGCACTATCTGCCGATACGGTGAACACAGTGAAG
ACACTACGAGACATCACAGAAACCGGTGTTGAGCCTTTAGCACTGATGTC
TCAGCTTGCCACAATAATTACTGATATTCTTGCTGGTTCCTATGCATTTA
CTCGAGAAAGGCCCAGGAGAAAGTTCTTCAAACGTCCTACCTTGTCAAAG
GAAGATATGGAAAAACTACGCCAGGCCTTGAAAACACTGTCTGAAGCTGA
AAAGCAGTTGAGGGTTTCTAGTGACAAAACAACCTGGCTTACAGCTGCAC
TGCTTCAGCTTGCTCCTGATAAACAGTACCTGTTGCCTAGTTCATCAACT
AGTACAAGTTTGAACCATGGTGTGCTGGTTGGTTCGTTTCCTGATAGGGG
TATAGGGAGGGCCTCAGCAGTTGAGCATAAAGGTAACCTGGCAAGCACGT
CTTATGGGGAAAGGAGAACTGTTGAACACACAGAAAATGGTCATGTGTTG
TCAACCAGTTCTGTCAGAGCAAATGAGGGAACTAAACACAGAAAAGCGGA
AAATGAAATGATCTGGCAAGCTGTGCTTGAGAGTATCCAATCAGATACAT
TGAGAAAAATGATGGCTAAAGAGGCCAGGCTAAACTCTGTCAGCCTAGGC
ACAGCACCAACAGCGCAACTAATATTTAGCTCACATATCAATAAGTCCAA
AGCCGAAAACTACAGAGCTCAGATTCTGCAGGCATTTGAGTCTGTTCTTC
GTTCTGCTATAATACTTGAAATCCGATATGAATCAAAGAATGACGCAAAA
GCAGGTCATGCTTCATCAATGTCTCCTTACCCTGGGAATGACTCCTCCAA
TGCGACACTGAGGAGGACCTTTACTAAACATAGTCCACTCTCTTATGGAG
GTGAGAATCTAATTACGAGGCTTAAAAAGGATAGTGTTGTGAAGGGAGCT
AACTCTAGTAAGACTAGATGGATGCAATCTGATCCCCACATATTAACAGA
AGGTGAAATAATTGAAGTTGGACCTTCTCACATGCATTGGCATGCTCAAA
CAAATAATGGTGCTCTTGACATAAATGAAAGAAGAAAGGAGAATGTATGG
GAGGAAGAAGCTTTGGCATCACCAAACCAAGAGAGCATGACTAATCGAAA
AGGAAGAAATGGGAACATACAGCGTCGACAGAACAACATAGTAAAAGGAA
AGGTATCTCTTGCTCATGTTATTGGGAGGGCAGAAGCTTGTTCTCAACGA
GGAGGCTGGACTAGACGAAAAGCTATATCGATTGCTGAAAAGCTAGAGCA
AGAGAATTTGAGGTTGGAGCCTAAATCGAGTCTGCTTTGTTGGAGAACCT
CAAGGACTCGTCGGAAGCTCTCTTCAATTAAGGTCAGGAATCGAAGGTCC
CGCCCTATATCAAGGCTCATATTGTGTGGAAGATGCATTTCGACCAAATC
TCCAAGATAA
back to top

protein sequence of Sh_008F19_p000030

>Sh_008F19_p000030 ID=Sh_008F19_p000030|Name=Sh_008F19_p000030|organism=R570 Sugarcane cultivar|type=polypeptide|length=1070bp
MPAPDRAAAGGGAGGHLRGHAHLTNCIHLRHHHGHAHGGAGAGGATSSGR
RRSPASVASASLMRDLLALQRSRSLRDPSTRRSVESSRVAADPDAYADTE
DDVDLPAVTTSRRSAGALKTLLDQLAENPHPHPKPGRRPPRRFKRRAGRR
ATAGSKPPDRAAALSVNSSSQEAVCGNIYLFHGDDDDDGGEELQQHLPQD
SRNVCGIPWNWSRLHHRGKSILDMAGRSLSCGLSDSKSAAGRKSEEAAAS
GGRVNASRPLFPVKSERLASSTSSDSDALPLLVEAATSSARNRIGAISGS
YSGELGIFSNQTSEMDSDLLSESQSGQKSQASQHGRGRHRSLTQKFAPKT
FKDVVGQSLVVQALSNAILRRKIGLVYVFYGPHGTGKTSCARVFAKALNC
LSSEHPRPCDSCTSCIAHNLGKSRGLMEIGPVGNIDMDCIVDVLDNVMLS
PAPSHYRVFIFDDCDTLPADTWSAISKVVDRAPRRVVFILVCPNLELPHI
ILSRCQKFFFPKLRESDIVNTLQWICTSESLDVDKDALKLIASRSDGSLR
DAEMTLDQLSLLGQRISLSLVQELVGLVSDDKLVDLLDLALSADTVNTVK
TLRDITETGVEPLALMSQLATIITDILAGSYAFTRERPRRKFFKRPTLSK
EDMEKLRQALKTLSEAEKQLRVSSDKTTWLTAALLQLAPDKQYLLPSSST
STSLNHGVLVGSFPDRGIGRASAVEHKGNLASTSYGERRTVEHTENGHVL
STSSVRANEGTKHRKAENEMIWQAVLESIQSDTLRKMMAKEARLNSVSLG
TAPTAQLIFSSHINKSKAENYRAQILQAFESVLRSAIILEIRYESKNDAK
AGHASSMSPYPGNDSSNATLRRTFTKHSPLSYGGENLITRLKKDSVVKGA
NSSKTRWMQSDPHILTEGEIIEVGPSHMHWHAQTNNGALDINERRKENVW
EEEALASPNQESMTNRKGRNGNIQRRQNNIVKGKVSLAHVIGRAEACSQR
GGWTRRKAISIAEKLEQENLRLEPKSSLLCWRTSRTRRKLSSIKVRNRRS
RPISRLILCGRCISTKSPR*
back to top

mRNA from alignment at Sh_008F19:18725..24516-

Legend: polypeptideexonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_008F19_t000030 ID=Sh_008F19_t000030|Name=Sh_008F19_t000030|organism=R570 Sugarcane cultivar|type=mRNA|length=5792bp|location=Sequence derived from alignment at Sh_008F19:18725..24516- (R570 Sugarcane cultivar)
ATGCCGGCGCCCGACCGTGCCGCGGCGGGGGGCGGTGCCGGGGGCCACCT CCGCGGCCACGCGCACCTCACCAACTGCATCCACCTCCGCCACCACCACG GGCACGCGCACGGGGGAGCGGGAGCGGGAGGCGCGACGTCGTCGGGCCGG AGGCGGAGCCCGGCGTCCGTGGCGTCCGCGTCGCTGATGCGCGACCTTCT CGCGCTGCAGCGCTCGCGATCGCTGCGGGACCCGTCCACGCGCCGCTCCG TCGAGTCGTCCAGGGTGGCGGCCGACCCCGACGCCTACGCCGACACCGAG GACGACGTCGATCTCCCCGCCGTCACCACGTCCCGCCGGAGCGCCGGGGC GCTCAAGACGCTCCTGGACCAGCTCGCCGAGAACCCCCACCCCCACCCGA AACCGGGCCGACGCCCGCCCCGCCGGTTCAAACGCCGGGCCGGCCGCCGC GCCACCGCTGGCAGTAAGCCTCCGGACCGCGCGGCCGCGCTCTCCGTCAA CTCCAGCTCCCAGGAGGCCGTCTGCGGCAACATATACCTGTTCCATGGCG ACGACGACGACGATGGCGGGGAGGAGCTGCAGCAGCATTTGCCGCAGGAC TCGCGCAACGTCTGTGGCATTCCATGGAACTGGTCGCGTCTGCACCACCG CGGCAAGTCCATCCTCGACATGGCCGGCCGCAGCCTTTCGTGCGGCCTCT CCGACTCCAAGTCGGCGGCGGGGCGAAAGTCTGAAGAAGCCGCCGCCTCG GGTGGCCGTGTCAATGCCTCGCGTCCCCTTTTCCCTGTTAAGTCCGAGAG GCTGGCCTCGTCGACCAGCTCGGACTCGGACGCGCTGCCCCTGCTGGTTG AGGCTGCCACCTCCAGTGCTCGGAACCGCATTGGCGCCATCTCTGGAAGC TACTCTGGAGAGCTTGGGATTTTCTCTAACCAGACCAGCGAGATGGACTC GGACCTGCTGTCTGAGTCTCAGTCAGGGCAGAAGTCACAGGCCTCGCAGC ATGGCCGTGGGCGTCACCGTAGTCTGACACAGAAATTCGCACCAAAGACG TTCAAAGACGTTGTTGGGCAGAGCTTGGTGGTGCAGGCGCTGTCCAATGC CATCCTGAGGAGGAAGATTGGGTTGGTGTATGTGTTCTATGGGCCGCACG GCACGGGCAAGACCTCATGTGCCCGTGTCTTCGCCAAGGCGCTCAATTGC CTCTCCTCTGAGCACCCCAGGCCCTGTGACTCGTGCACGTCGTGCATCGC TCACAATCTTGGCAAGAGCAGAGGCCTGATGGAGATTGGGCCTGTTGGCA ACATCGACATGGATTGCATTGTGGACGTCCTCGATAATGTGATGCTTTCA CCAGCACCATCACACTACAGGGTGTTTATATTTGATGACTGTGATACTCT GCCAGCTGACACTTGGAGTGCTATCTCTAAAGTTGTGGACCGGGCACCCC GTCGCGTTGTGTTTATCCTTGTCTGTCCAAACCTTGAACTTCCTCATATC ATCCTGTCCAGATGCCAGAAGTTCTTTTTCCCAAAGCTGAGGGAGTCCGA CATTGTCAATACATTGCAGTGGATTTGCACCAGCGAGAGTCTAGATGTTG ATAAAGATGCACTGAAGCTAATTGCATCCCGTTCTGATGGATCTTTGAGG GATGCCGAGATGACTCTTGATCAACTCAGTTTGCTGGGACAAAGGATTTC CTTGTCTCTTGTCCAAGAATTGGTAAGATATCTCACAAGCATTACAGTAT CATCTATGTTTTTTTTTCCCACGTTACTCTGCAATTTCTATGGCTGAATA TAAATTTCTGGAGGATTTTACGGTCAATATCTTGATAACTTTAGTGCTGC TGAAACATGTCATATAATCTAATTAAATAGATAGTAGTGTGCAAATTTGT TTCCCCATATATCTAGTATTCAAACGTCCTTTAAATTATAGTCAGATGCA AATTGCAAGCACTACTATCTTACTGGTATATTCTTATTTCTGTGCTGAAC TAAGTTAGTAACTGATTTTGTATCCCTGTGACAGGGATCATAATTCTGTT TTCATTTAGTTCTTTTCATCATCCGGTCTGCTCTGACACAACAATAAAAT GTTAGTCCCCCGTTTGTTTTACAGGTTGGCCTGGTGTCTGATGATAAACT GGTTGATTTGCTTGATTTGGCACTATCTGCCGATACGGTGAACACAGTGA AGACACTACGAGACATCACAGAAACCGGTGTTGAGCCTTTAGCACTGATG TCTCAGCTTGCCACAATAATTACTGATATTCTTGCTGGTTCCTATGCATT TACTCGAGAAAGGCCCAGGAGAAAGTTCTTCAAACGTCCTACCTGTAAGC AATGTTCATTAGCCACAGTATAGTTCAAAAATATTCAAAAAATTTCCATC ATCACTGTTCTCTTACGGTAAAATTCTGCATTGGCATAATCTAGTTCCTT TTATTTTTCCATGATTTCCAGTGTCAAAGGAAGATATGGAAAAACTACGC CAGGCCTTGAAAACACTGTCTGAAGCTGAAAAGCAGTTGAGGGTTTCTAG TGACAAAACAACCTGGCTTACAGCTGCACTGCTTCAGCTTGCTCCTGATA AACAGTACCTGTTGCCTAGTTCATCAACTAGTACAAGTTTGAACCATGGT GTGCTGGTTGGTTCGTTTCCTGATAGGGGTATAGGGAGGGCCTCAGCAGT TGAGCATAAAGGTAACCTGGCAAGCACGTCTTATGGGGAAAGGAGAACTG TTGAACACACAGAAAATGGTCATGTGTTGTCAACCAGTTCTGTCAGAGCA AATGAGGGAACTAAACACAGAAAAGCGGAAAATGAAATGATCTGGCAAGC TGTGCTTGAGAGTATCCAATCAGATACATTGAGAAAAATGATGGCTAAAG AGGCCAGGCTAAACTCTGTCAGCCTAGGCACAGGTAAGGTTCTCAATCTG TCATCCATATCAGTTTTTGCAATCATCACAATTTGTCCAAGAATAAGTTT CTATAATTCAGTGCTTAATATTTGCAAAAAAAAAAAGAGACCCAGTGCTT AAAACAGAGAGGAAAAGCTCGTTTAGAAATATTTTGTATAAACAGTATAA AAAGACATTTCAACCAAGTTTTTGCTTGCTTTTTTTTTGTGGTATTGGTG CTTCTAGTAACTCTTGGATTTTTTCTGAAGTAAGATGCAGTACTCTTGCT TTTATCTCGGCTCCGAACAAAGTATCGGATATCTATCATTGGGTTTATGG CATCCTTTTAGGTGTAGGAATACAAACATTATAACTTTACTGCTGAGGTC AAAGTGTATGGAAGAAAGTAGCAATGTAGAAGCATGTAGCTAGCTAAGCT CATAAAATTCTATTTGTACTGTTTTGACTTTTTACTGTTGTTGCTTTGCA CATATATTCTAAGCTGCAATGCCTCTGATAGTGGTTAATTGGTGTTCTCA GTCTCAATCCGTATAACTTTATGTGGTCTTTCACTTGAGTACTTGATGCA AAGTGTTGCTAGATTGTCTTTCTAGCAGATCATTTTCTAACATCAGCTTC CTTTCTTCCAACAGCACCAACAGCGCAACTAATATTTAGCTCACATATCA ATAAGTCCAAAGCCGAAAACTACAGAGCTCAGATTCTGCAGGCATTTGAG TCTGTTCTTCGTTCTGCTATAATACTTGAAATCCGATATGAATCAAAGAA TGACGCAAAAGCAGGTCATGCTTCATCAATGTCTCCTTACCCTGGGAATG ACTCCTCCAATGCGACACTGAGGAGGACCTTTACTAAACATAGTCCACTC TCTTATGGAGGTGAGAATCTAATTACGAGGCTTAAAAAGGATAGTGTTGT GAAGGGAGCTAACTCTAGTAAGACTAGATGGATGCAATCTGATCCCCACA TATTAACAGAAGGTGAAATAATTGAAGTTGGACCTTCTCACATGCATTGG CATGCTCAAACAAATAATGGTGCTCTTGACATAAATGAAAGAAGAAAGGA GAATGTATGGGAGGAAGAAGCTTTGGCATCACCAAACCAAGAGAGCATGA CTAATCGAAAAGGAAGAAATGGGAACATACAGCGTCGACAGAACAACATA GTAAAAGGAAAGGTATCTCTTGCTCATGTTATTGGGAGGGCAGAAGCTTG TTCTCAACGAGGAGGCTGGACTAGACGAAAAGCTATATCGATTGCTGAAA AGCTAGAGCAAGAGAATTTGTAAGTGTTGTTATCCTGCAATCAACTCAGT CAAACTTTTATATAAGAACTCATGCTTGTGTGTTTTCACATTAGAAATAA TAAAATAAATCTCGTATGAAAAAAGTTCTGCCAACACCCAATGGTCTCAT AATAATTTTCCTGAAATCACAAGGACCATTAAACATGTAGGGGGTCAATA CTCCATACCATTGTACCAAACATGTTTCGACTCATTTGTCAATTGAGGTT GTGCATTTGTACTGCATGTTTCTCACCGGTAAAGTATTTGTACGCAGGAG GTTGGAGCCTAAATCGAGTCTGCTTTGTTGGAGAACCTCAAGGACTCGTC GGAAGGTAATCTTTCATATTTGTATTATATCATAATCTGTGGATACCCCA ATGAATTCAGTGTTACTGGGTCGAAACTTTCATTTTAGCTTGTATCAGCT ATTTTCATCTCTGAGACTCTTGACTCATTTACGTAAAAATCGAGACAACT CATTTTGCATATTAGTCTGATAAAATTTGAGACAACTCATTTGCATATAT TATAAAAAAAGAAGCTTGTCTGAAAAATATTGTGGATGTATCGAACAGAT CAGTTAATCATGTATTTTTACTTAAAGTCTGGATAGTTCCATAGTCTCCT TTCACCTGAACATGTACGTGGATTTGATATATCCTTAGTTCAGTCATTTC TCGAGTCAAAATTACTCTTTAAAGAAATAGATCTTATCTTGTCACGAATT TGTTTAAGTAGAAGAGTACCATACTACCATGCCTCTAAACAGATTAACCA AGTGCCAAGGGAGAGGAACATTCTGGGACTCTTGATTCTGAAGAGAAGAG AATTGGTGTCATCTTGCATGCATGCTAAATTGATTTCTGCCATCCTTGCG GGACTTTACATCTCATTGATATGGCTGCAGAGTGTAAACAAGTGAAGATT AGCATCTGTTTATTTATACTCCTGTGGTGATGGCAATTTTATAGATGGTA TTTTGCCAAAATTGTGGTCAGAATTATAATAGCTTTTCGAGGTTTTGTGT GGCTGCAACAGAGCACTTTTGTGATTATAATCTTACAAGGTTTTATAGGT AGGTCAGGATAGCATTATTAGTCAAAATCGTGTTCCGGAGAGTCTGAGTT TCTGGGCAATTGCAACGGAGCATTTGAAATCCTGCTTGGCTTAAAATAGA GTTGTGCTTGATGATTTTACCTTCTCTGACTAATTCAATTATTTCCCCAC AGCTCTCTTCAATTAAGGTCAGGAATCGAAGGTCCCGCCCTATATCAAGG CTCATATTGTGTGGAAGATGCATTTCGACCAAATCTCCAAGATAAGAATT TGAATCGTAGATTTTACAACCTGTTAACTTAGCATTCATAATTTATTCTG TCTGTACCTTGTAGGCTGTAGCCGTGCCAGTTTGTAGATCCTGTTGTCTC TCTCAATTCTGTATATTTCTTGACATGTAAAAAACGATGATAGAAGTGGC ATAGCAAATTCTTCTGTCAAAATGCTGTGTAAATTTTTTATAGGCAGACC AAAATAAAAACTTTGTATTCGGAAGTCTCTAATAAATGCCTT
back to top

Coding sequence (CDS) from alignment at Sh_008F19:18725..24516-

>Sh_008F19_t000030 ID=Sh_008F19_t000030|Name=Sh_008F19_t000030|organism=R570 Sugarcane cultivar|type=CDS|length=3210bp|location=Sequence derived from alignment at Sh_008F19:18725..24516- (R570 Sugarcane cultivar)
ATGCCGGCGCCCGACCGTGCCGCGGCGGGGGGCGGTGCCGGGGGCCACCT
CCGCGGCCACGCGCACCTCACCAACTGCATCCACCTCCGCCACCACCACG
GGCACGCGCACGGGGGAGCGGGAGCGGGAGGCGCGACGTCGTCGGGCCGG
AGGCGGAGCCCGGCGTCCGTGGCGTCCGCGTCGCTGATGCGCGACCTTCT
CGCGCTGCAGCGCTCGCGATCGCTGCGGGACCCGTCCACGCGCCGCTCCG
TCGAGTCGTCCAGGGTGGCGGCCGACCCCGACGCCTACGCCGACACCGAG
GACGACGTCGATCTCCCCGCCGTCACCACGTCCCGCCGGAGCGCCGGGGC
GCTCAAGACGCTCCTGGACCAGCTCGCCGAGAACCCCCACCCCCACCCGA
AACCGGGCCGACGCCCGCCCCGCCGGTTCAAACGCCGGGCCGGCCGCCGC
GCCACCGCTGGCAGTAAGCCTCCGGACCGCGCGGCCGCGCTCTCCGTCAA
CTCCAGCTCCCAGGAGGCCGTCTGCGGCAACATATACCTGTTCCATGGCG
ACGACGACGACGATGGCGGGGAGGAGCTGCAGCAGCATTTGCCGCAGGAC
TCGCGCAACGTCTGTGGCATTCCATGGAACTGGTCGCGTCTGCACCACCG
CGGCAAGTCCATCCTCGACATGGCCGGCCGCAGCCTTTCGTGCGGCCTCT
CCGACTCCAAGTCGGCGGCGGGGCGAAAGTCTGAAGAAGCCGCCGCCTCG
GGTGGCCGTGTCAATGCCTCGCGTCCCCTTTTCCCTGTTAAGTCCGAGAG
GCTGGCCTCGTCGACCAGCTCGGACTCGGACGCGCTGCCCCTGCTGGTTG
AGGCTGCCACCTCCAGTGCTCGGAACCGCATTGGCGCCATCTCTGGAAGC
TACTCTGGAGAGCTTGGGATTTTCTCTAACCAGACCAGCGAGATGGACTC
GGACCTGCTGTCTGAGTCTCAGTCAGGGCAGAAGTCACAGGCCTCGCAGC
ATGGCCGTGGGCGTCACCGTAGTCTGACACAGAAATTCGCACCAAAGACG
TTCAAAGACGTTGTTGGGCAGAGCTTGGTGGTGCAGGCGCTGTCCAATGC
CATCCTGAGGAGGAAGATTGGGTTGGTGTATGTGTTCTATGGGCCGCACG
GCACGGGCAAGACCTCATGTGCCCGTGTCTTCGCCAAGGCGCTCAATTGC
CTCTCCTCTGAGCACCCCAGGCCCTGTGACTCGTGCACGTCGTGCATCGC
TCACAATCTTGGCAAGAGCAGAGGCCTGATGGAGATTGGGCCTGTTGGCA
ACATCGACATGGATTGCATTGTGGACGTCCTCGATAATGTGATGCTTTCA
CCAGCACCATCACACTACAGGGTGTTTATATTTGATGACTGTGATACTCT
GCCAGCTGACACTTGGAGTGCTATCTCTAAAGTTGTGGACCGGGCACCCC
GTCGCGTTGTGTTTATCCTTGTCTGTCCAAACCTTGAACTTCCTCATATC
ATCCTGTCCAGATGCCAGAAGTTCTTTTTCCCAAAGCTGAGGGAGTCCGA
CATTGTCAATACATTGCAGTGGATTTGCACCAGCGAGAGTCTAGATGTTG
ATAAAGATGCACTGAAGCTAATTGCATCCCGTTCTGATGGATCTTTGAGG
GATGCCGAGATGACTCTTGATCAACTCAGTTTGCTGGGACAAAGGATTTC
CTTGTCTCTTGTCCAAGAATTGGTTGGCCTGGTGTCTGATGATAAACTGG
TTGATTTGCTTGATTTGGCACTATCTGCCGATACGGTGAACACAGTGAAG
ACACTACGAGACATCACAGAAACCGGTGTTGAGCCTTTAGCACTGATGTC
TCAGCTTGCCACAATAATTACTGATATTCTTGCTGGTTCCTATGCATTTA
CTCGAGAAAGGCCCAGGAGAAAGTTCTTCAAACGTCCTACCTTGTCAAAG
GAAGATATGGAAAAACTACGCCAGGCCTTGAAAACACTGTCTGAAGCTGA
AAAGCAGTTGAGGGTTTCTAGTGACAAAACAACCTGGCTTACAGCTGCAC
TGCTTCAGCTTGCTCCTGATAAACAGTACCTGTTGCCTAGTTCATCAACT
AGTACAAGTTTGAACCATGGTGTGCTGGTTGGTTCGTTTCCTGATAGGGG
TATAGGGAGGGCCTCAGCAGTTGAGCATAAAGGTAACCTGGCAAGCACGT
CTTATGGGGAAAGGAGAACTGTTGAACACACAGAAAATGGTCATGTGTTG
TCAACCAGTTCTGTCAGAGCAAATGAGGGAACTAAACACAGAAAAGCGGA
AAATGAAATGATCTGGCAAGCTGTGCTTGAGAGTATCCAATCAGATACAT
TGAGAAAAATGATGGCTAAAGAGGCCAGGCTAAACTCTGTCAGCCTAGGC
ACAGCACCAACAGCGCAACTAATATTTAGCTCACATATCAATAAGTCCAA
AGCCGAAAACTACAGAGCTCAGATTCTGCAGGCATTTGAGTCTGTTCTTC
GTTCTGCTATAATACTTGAAATCCGATATGAATCAAAGAATGACGCAAAA
GCAGGTCATGCTTCATCAATGTCTCCTTACCCTGGGAATGACTCCTCCAA
TGCGACACTGAGGAGGACCTTTACTAAACATAGTCCACTCTCTTATGGAG
GTGAGAATCTAATTACGAGGCTTAAAAAGGATAGTGTTGTGAAGGGAGCT
AACTCTAGTAAGACTAGATGGATGCAATCTGATCCCCACATATTAACAGA
AGGTGAAATAATTGAAGTTGGACCTTCTCACATGCATTGGCATGCTCAAA
CAAATAATGGTGCTCTTGACATAAATGAAAGAAGAAAGGAGAATGTATGG
GAGGAAGAAGCTTTGGCATCACCAAACCAAGAGAGCATGACTAATCGAAA
AGGAAGAAATGGGAACATACAGCGTCGACAGAACAACATAGTAAAAGGAA
AGGTATCTCTTGCTCATGTTATTGGGAGGGCAGAAGCTTGTTCTCAACGA
GGAGGCTGGACTAGACGAAAAGCTATATCGATTGCTGAAAAGCTAGAGCA
AGAGAATTTGAGGTTGGAGCCTAAATCGAGTCTGCTTTGTTGGAGAACCT
CAAGGACTCGTCGGAAGCTCTCTTCAATTAAGGTCAGGAATCGAAGGTCC
CGCCCTATATCAAGGCTCATATTGTGTGGAAGATGCATTTCGACCAAATC
TCCAAGATAA
back to top