Sh_008F19_t000060

Overview
NameSh_008F19_t000060
Unique NameSh_008F19_t000060
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length495
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_008F19contigSh_008F19:87272..88663
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteConserved hypothetical protein
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_008F19_g000060Sh_008F19_g000060R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_008F19_p000060Sh_008F19_p000060R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_008F19_t000060 ID=Sh_008F19_t000060|Name=Sh_008F19_t000060|organism=R570 Sugarcane cultivar|type=mRNA|length=495bp
ATGCGGCAAGACGCCGTCGCCGCCGCGCCCACGGCGGCCGGCGCCTCGCC
GCCGATCCCCCTCCCGATGGATGCTGTGGTCATCGATATCGAGGGGGCGC
CTTTGCCGGCGGAGGCCCCCGGGCTGGGGTGCCGGATCTGCCACCTCGGT
CCCGAGGACGGCGAGGCGGTGGTGCCAGGTTCCGAGGTGATACGTCTAGG
CTGCGGCTGCAAGGACGAGCTCGGCGCCGCGCACCGGCAATGCGCCGAGG
CGTGGTTTAGGATCAAGGGCGATAGGCGCTGTGAAATATGTGGTTCAGAT
GCCAAAAACATTACCGGGTTGGAAGTGAAAAAATTCATGGAGCAGTGGCA
TGGCCGAAGAGTGGCACACACCCAAACTACTGAGGAGAGAGAAAGTCATT
GTTATTGGAGACAGCAGCCCTTCTGTAATTTCTTGTTAGCAAGCTTACTG
ATTGTTTTCATGCTGCCCTGGTTTCTCCGTGTAAATTTGTTTTGA
back to top

protein sequence of Sh_008F19_p000060

>Sh_008F19_p000060 ID=Sh_008F19_p000060|Name=Sh_008F19_p000060|organism=R570 Sugarcane cultivar|type=polypeptide|length=165bp
MRQDAVAAAPTAAGASPPIPLPMDAVVIDIEGAPLPAEAPGLGCRICHLG
PEDGEAVVPGSEVIRLGCGCKDELGAAHRQCAEAWFRIKGDRRCEICGSD
AKNITGLEVKKFMEQWHGRRVAHTQTTEERESHCYWRQQPFCNFLLASLL
IVFMLPWFLRVNLF*
back to top

mRNA from alignment at Sh_008F19:87272..88663-

Legend: polypeptideexonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_008F19_t000060 ID=Sh_008F19_t000060|Name=Sh_008F19_t000060|organism=R570 Sugarcane cultivar|type=mRNA|length=1392bp|location=Sequence derived from alignment at Sh_008F19:87272..88663- (R570 Sugarcane cultivar)
ATGCGGCAAGACGCCGTCGCCGCCGCGCCCACGGCGGCCGGCGCCTCGCC GCCGATCCCCCTCCCGATGGATGCTGTGGTCATCGATATCGAGGGGGCGC CTTTGCCGGCGGAGGCCCCCGGGCTGGGGTGCCGGATCTGCCACCTCGGT CCCGAGGACGGCGAGGCGGTGGTGCCAGGTTCCGAGGTGATACGTCTAGG CTGCGGCTGCAAGGACGAGCTCGGCGCCGCGCACCGGCAATGCGCCGAGG CGTGGTTTAGGATCAAGGGCGATAGGTATCCCTCGCTCAATCCTGCGCTG GATCATCTGGATCCTGTTGCTCGCTTTCTTTGATATATACAAATATATGC AATGATCTGGGGTTGGGATGCGGGATAGGTGTTTGCGCTAATTCCCTAGC GAGTGCCGCAAGCCTGCAACGGTACAGGGGCTGTAGGGGCGTTGTGACTG CACATACGGTGAATGGTGATGAATTAACTCGTAGTAACTCGTAAGAGAGT ATTTTGATCTGAATAGTTCTAGGGTCATACCAGTTTCGTAGGCAAACTCT CGAATTCACATGGGGCAGCTGGAACAATGCAGCTATTTTACTGCAACCCT ACACTAATACTAGCATGCCTTTAGCTTGATGGACTTATCTGAAGCCGCAG GTTCAAATGTTGAGCGAAAACATTGATTACCTGATGAGGCCTCCTCTGTT TTTTTGGGAGGAAAATGATGGCGTAGATGAAGCAAAGAACTATATTCGTG CGCTTTGGTTGCTGGGCCCGTACTTTTCAGTTTTTGCATCGGTGATCTGT GACTGCTTTAAGGCTTTATGTCACTCTCATGTGCAAGCTGCTTGCCTTTT CACACACACTGTTTACTGTTATAAGGCCAACTGATTCAGCAAGGTTTTCG TAGTTTGCAGATAGCAGCACTTCGCTTTATTTATCATCTTTATGCTTTCA CAATCTCATATTGATCTCTCGTTAGATCTCTGGAACTTGTGTCAAGTTAC CAAGAATTTTAAACCTTTAGTTTCCATGCAGGCGCTGTGAAATATGTGGT TCAGATGCCAAAAACATTACCGGGTTGGAAGTGAAAAAATTCATGGAGCA GTGGCATGGCCGAAGAGTGGCACACACCCAAACTACTGAGGAGAGAGAAA GTCATTGTTATTGGAGACAGCAGCCCTTCTGTAATTTCTTGTTAGCAAGC TTACTGATTGTTTTCATGCTGCCCTGGTTTCTCCGTGTAAATTTGTTTTG ATTTTGCTTCCACTATTGGGCCATGTGGATTCACAGCTTGTTAGCTCGGC TACCATCCTAAGGATGGATTGTGTAGATATCCATAGGCACAACCACAGCA CAGCTCCTGAAATATATATTTTTAAAGAAATTCCCTTTCGAT
back to top

Coding sequence (CDS) from alignment at Sh_008F19:87272..88663-

>Sh_008F19_t000060 ID=Sh_008F19_t000060|Name=Sh_008F19_t000060|organism=R570 Sugarcane cultivar|type=CDS|length=495bp|location=Sequence derived from alignment at Sh_008F19:87272..88663- (R570 Sugarcane cultivar)
ATGCGGCAAGACGCCGTCGCCGCCGCGCCCACGGCGGCCGGCGCCTCGCC
GCCGATCCCCCTCCCGATGGATGCTGTGGTCATCGATATCGAGGGGGCGC
CTTTGCCGGCGGAGGCCCCCGGGCTGGGGTGCCGGATCTGCCACCTCGGT
CCCGAGGACGGCGAGGCGGTGGTGCCAGGTTCCGAGGTGATACGTCTAGG
CTGCGGCTGCAAGGACGAGCTCGGCGCCGCGCACCGGCAATGCGCCGAGG
CGTGGTTTAGGATCAAGGGCGATAGGCGCTGTGAAATATGTGGTTCAGAT
GCCAAAAACATTACCGGGTTGGAAGTGAAAAAATTCATGGAGCAGTGGCA
TGGCCGAAGAGTGGCACACACCCAAACTACTGAGGAGAGAGAAAGTCATT
GTTATTGGAGACAGCAGCCCTTCTGTAATTTCTTGTTAGCAAGCTTACTG
ATTGTTTTCATGCTGCCCTGGTTTCTCCGTGTAAATTTGTTTTGA
back to top