Sh_008F19_t000070

Overview
NameSh_008F19_t000070
Unique NameSh_008F19_t000070
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length357
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_008F19contigSh_008F19:90839..91195
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteMitochondrial import receptor subunit TOM7-1
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_008F19_g000070Sh_008F19_g000070R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_008F19_p000070Sh_008F19_p000070R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_008F19_t000070 ID=Sh_008F19_t000070|Name=Sh_008F19_t000070|organism=R570 Sugarcane cultivar|type=mRNA|length=357bp
ATGGAGCACCTCGACAAATTTGTTCCCTGTCGCGATTCATCCGTCAGCGG
CCTCCTGGCCTATCACGAGCTGCAATCTCCAGCGGTCCAGCCTATTATTC
CTTCCTCTCTCTCCCTCTCGTCTTCTCAACTGACGGAGGCGGAGATGGCA
TCTGGCACGGCGGAGAAGGGAAAGGCCCTGGCGGACGGGGCGGAGTCAGC
GGCGGAGAGCGCGGCGCGGCGGGCGCGGGAGTGGAGCACGTGGGCGATGA
AGAAGGCCAAGGTGGTGGCCCACTACGGCTTCATTCCCGTCGTCATCCTC
ATCGGCATGAACTCCGAGCCCAAGCCGCGCCTCGCCCAGCTCCTCTCCCC
GATCTAG
back to top

protein sequence of Sh_008F19_p000070

>Sh_008F19_p000070 ID=Sh_008F19_p000070|Name=Sh_008F19_p000070|organism=R570 Sugarcane cultivar|type=polypeptide|length=119bp
MEHLDKFVPCRDSSVSGLLAYHELQSPAVQPIIPSSLSLSSSQLTEAEMA
SGTAEKGKALADGAESAAESAARRAREWSTWAMKKAKVVAHYGFIPVVIL
IGMNSEPKPRLAQLLSPI*
back to top

mRNA from alignment at Sh_008F19:90839..91195-

Legend: polypeptideexonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_008F19_t000070 ID=Sh_008F19_t000070|Name=Sh_008F19_t000070|organism=R570 Sugarcane cultivar|type=mRNA|length=357bp|location=Sequence derived from alignment at Sh_008F19:90839..91195- (R570 Sugarcane cultivar)
ATGGAGCACCTCGACAAATTTGTTCCCTGTCGCGATTCATCCGTCAGCGG CCTCCTGGCCTATCACGAGCTGCAATCTCCAGCGGTCCAGCCTATTATTC CTTCCTCTCTCTCCCTCTCGTCTTCTCAACTGACGGAGGCGGAGATGGCA TCTGGCACGGCGGAGAAGGGAAAGGCCCTGGCGGACGGGGCGGAGTCAGC GGCGGAGAGCGCGGCGCGGCGGGCGCGGGAGTGGAGCACGTGGGCGATGA AGAAGGCCAAGGTGGTGGCCCACTACGGCTTCATTCCCGTCGTCATCCTC ATCGGCATGAACTCCGAGCCCAAGCCGCGCCTCGCCCAGCTCCTCTCCCC GATCTAG
back to top

Coding sequence (CDS) from alignment at Sh_008F19:90839..91195-

>Sh_008F19_t000070 ID=Sh_008F19_t000070|Name=Sh_008F19_t000070|organism=R570 Sugarcane cultivar|type=CDS|length=357bp|location=Sequence derived from alignment at Sh_008F19:90839..91195- (R570 Sugarcane cultivar)
ATGGAGCACCTCGACAAATTTGTTCCCTGTCGCGATTCATCCGTCAGCGG
CCTCCTGGCCTATCACGAGCTGCAATCTCCAGCGGTCCAGCCTATTATTC
CTTCCTCTCTCTCCCTCTCGTCTTCTCAACTGACGGAGGCGGAGATGGCA
TCTGGCACGGCGGAGAAGGGAAAGGCCCTGGCGGACGGGGCGGAGTCAGC
GGCGGAGAGCGCGGCGCGGCGGGCGCGGGAGTGGAGCACGTGGGCGATGA
AGAAGGCCAAGGTGGTGGCCCACTACGGCTTCATTCCCGTCGTCATCCTC
ATCGGCATGAACTCCGAGCCCAAGCCGCGCCTCGCCCAGCTCCTCTCCCC
GATCTAG
back to top