Sh_008G08_p000050

Overview
NameSh_008G08_p000050
Unique NameSh_008G08_p000050
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length588
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_008G08contigSh_008G08:55766..58171
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC2.3.2.21
InterProIPR013324
InterProIPR007624
InterProIPR007627
InterProIPR013325
InterProIPR016262
InterProIPR007630
InterProIPR011991
InterProIPR014284
InterProIPR000943
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_008G08_t000050Sh_008G08_t000050R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_008G08_p000050 ID=Sh_008G08_p000050|Name=Sh_008G08_p000050|organism=R570 Sugarcane cultivar|type=polypeptide|length=588bp
MGFQLIHGRPCAYCCPSSSSSSSSWMMQALPPKQSHHPLNGRKPIFSESL
AALAAMHLLLKRRRDRSSRDIASSAGVLQITENKSAAANLTKHKQVSAER
KLLDDALDRTTVQYESWMDEETSFWMERDHTNSTLQYGLLMQNLQELETS
LAGKDLKMLENDILAHIQQLGALRSFNASMTLGANLLDTLTHVSSPYDQS
DSSLLDHLIIKFDPETPLDEEQEDSEVVVVRSGKSQERKLKRTRASEKGS
RKSVKVNPRTPKKSRKASSSQFISEWKSHPGRRRIIVREQSALLATIKEC
ASLEKIREKMAKEGQEVSYHRWAEAAGMDEAELMSRLQAGYCCRERLLVT
TEWLVRCIARSYTGMGTALDDLLQAGKMGVLDGAEKFDTRKGCRFSTYVK
YWIRKGMLALLAENSGVTLLPARMESIMRKVKEARRGIRYSQGRNPSDSE
IAAAVGVSVANVRLARKCSRRPVSLYSEIGIGQHAKFAEVIPDEAAASVE
APDEAALFRGQLRERLLLVLGRLPAREGHVLRLRHGLEDGRCRSLEEIGG
MYRVSKEWIRKIEKSAMARLRDDDDVRRDLHDFVCRF*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0016987sigma factor activity
Vocabulary: Biological Process
TermDefinition
GO:0006352DNA-templated transcription, initiation
GO:0006355regulation of transcription, DNA-templated