Sh_008G08_t000010

Overview
NameSh_008G08_t000010
Unique NameSh_008G08_t000010
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1753
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_008G08contigSh_008G08:1..2746
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_008G08_g000010Sh_008G08_g000010R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_008G08_p000010Sh_008G08_p000010R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_008G08_t000010 ID=Sh_008G08_t000010|Name=Sh_008G08_t000010|organism=R570 Sugarcane cultivar|type=mRNA|length=1753bp
TCACTGGGTGAACATGGGTACACCAATGTCGCCATGGAAGGGGCGGCTGC
GCTCTCACCACGCGACCCCTCAAATTTTTCCCAAGAGGAGGCTCCCTTCC
CAGACCAAGAACCTGGAGGAGAAAGAGAAGCTCCAAACATTGAAGAAGCC
TCAAAGTTTGCCCAAGAGGAGGCTCCCTTCCCAGACCGAGAACCCAGAGG
AGAAAGAGGAGCTCCAAACATCGAAGAAGCTGGCTGCCCCCAAGAAGACA
GCGAGAGGTCACCACACTGGAGCTGCTGTACAGCAGCCGAGGGCGCCCTT
ACGCCAGTCGTCGCGGCTCGCTGGAAGAGACCTTGAGCATCCAATTGTGA
TAGATGATGATGAACATAAAGCCAGGGCTGATCAATCAGCAATTACGCCT
CTTCGCAGATCCCCACGATTCCATGTGGAAGATAAGAGTTTGGGCAAGTC
ACTGTTGCCACCAAATCGGCGGGAGACCTCTGCTAACAGAAAGACTAAAA
CAGCTCATAGGAAAGACAAAAATCAAGAGAGCCTGAAAAGGAATAGGGGA
AGTGCTGGATTTCCTCCTAGGAAAGATATTTCAGATGTATCTAACAAAAA
GAGTGACAAGCAAGAGTTAAAGTCCAATCATTGTAAAGTTCAGACAGGAA
AGAGGAAGAGAGGAACAGAAAGGAGGGTTTCATCGAAGAAGCAAAGTTGC
CAGGACCCCGAACCATTGCCTGTGTATTGCCAAGAAATTGCACCTCGCAA
TGTACCCATAAAATCCACCCACAGAAGGATTGAAAAGGACCCTTCTATTG
AGGTGAAGCTTAAAGTTGGTGATGAGAGGTTGAACATTGATGAAAACATC
AACAAGCCAAGTGGGACTGAGAGAAAAGGAACTGGAAATTTTTGTGGTTC
TGATGATTGGACAAAAGAGCAGGACATGGTATTGCGCAAAGCTTACTTCA
GTGCCCGACCATCCCCACATTTCTGGAAGAAAGTTTCAAAAATGGTGCCA
GGGAGATCTGCTGAAGACTGCTTCAACAGAATATATTCTGACCTCTCAAC
ACCGACTCCAATTGGCCCACGTTCCAGAACAAGTAAAACAACATATTCTC
CTATAGGAAATTTCACACTGTCTGATCCAAAACTTTCAAATATCTTGGAA
CCTACAGTCGGAAGGCGAAAGACTGCTAAACAAAAGAGTCTAGTAGCACA
GAAGACAGTGAAGCATCTGTTGCAGAAGCATTGCCGCATTGACCAAGCTC
AAGAGGCTGACCACTTCTCAATTTTTGAAAGCTCACCAAGTGCCTTACAA
TTGAACTTATCTTTTGAAGATTCTCCTGGGACTCCTGACAGTTGTATGAA
TTCAGCTTCTCTAGGAAAGCGTAGTGGAAGTTCTTCAGCACGAAAGAAAC
CATTTTCAAGGTTAAGAACTAAGCCATCTGAACCGAGCCCATCAGTTCTA
AAGCCTATAAAGAATGTTATCTTACATGAGAAGTACATTGATCAATTGGC
ACGTAGAGAAGGCACAAAAAGGCCTCGCAGAAGGACTCCAGCAGGCTCTA
AAGCTGCTGGTTCTGGGAATTCTCTTTCTGAGCAGCAAGCTGGTAGTGTG
AAGGCTGCTAAAAATGCTCTCATCTCAGAAGCAACCGACTTCATAAGCAG
TTTTAAGACGCTGCAAGCCGATTCCCTTGCGCATGTTGTGGAGAATAGTG
AAGACGAGATTGAATGTGATGCCAGTGATTGTAGCCATGATGATAAAGAA
TAA
back to top

protein sequence of Sh_008G08_p000010

>Sh_008G08_p000010 ID=Sh_008G08_p000010|Name=Sh_008G08_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=584bp
HWVNMGTPMSPWKGRLRSHHATPQIFPKRRLPSQTKNLEEKEKLQTLKKP
QSLPKRRLPSQTENPEEKEELQTSKKLAAPKKTARGHHTGAAVQQPRAPL
RQSSRLAGRDLEHPIVIDDDEHKARADQSAITPLRRSPRFHVEDKSLGKS
LLPPNRRETSANRKTKTAHRKDKNQESLKRNRGSAGFPPRKDISDVSNKK
SDKQELKSNHCKVQTGKRKRGTERRVSSKKQSCQDPEPLPVYCQEIAPRN
VPIKSTHRRIEKDPSIEVKLKVGDERLNIDENINKPSGTERKGTGNFCGS
DDWTKEQDMVLRKAYFSARPSPHFWKKVSKMVPGRSAEDCFNRIYSDLST
PTPIGPRSRTSKTTYSPIGNFTLSDPKLSNILEPTVGRRKTAKQKSLVAQ
KTVKHLLQKHCRIDQAQEADHFSIFESSPSALQLNLSFEDSPGTPDSCMN
SASLGKRSGSSSARKKPFSRLRTKPSEPSPSVLKPIKNVILHEKYIDQLA
RREGTKRPRRRTPAGSKAAGSGNSLSEQQAGSVKAAKNALISEATDFISS
FKTLQADSLAHVVENSEDEIECDASDCSHDDKE*
back to top

mRNA from alignment at Sh_008G08:1..2746+

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_008G08_t000010 ID=Sh_008G08_t000010|Name=Sh_008G08_t000010|organism=R570 Sugarcane cultivar|type=mRNA|length=2746bp|location=Sequence derived from alignment at Sh_008G08:1..2746+ (R570 Sugarcane cultivar)
CTGGAAGTTTTTCAGTGTGTGTTTCCTAGAAACATAGTCATGTAGATTTA CTGAAAGGTGCAGTGAATTTTTTGCGCTTTGTGCAGTGCAGGTGCGTCCT GATGCATATTTTGTTGCATTAATGTTTTTTTGTCTTCCCTTGCAACATAC GAGCGAACACTATTTGTTTATCAATTGATTTTGACCCACAATATTTTTCA CTCTTATTGTGTTAGAAAAATTTGAGACTCCCGTGGCAACGCACAGGCAT CTGCTAGTCTAACTACAAGTTTATATATGTATTATGCCTACTGACTTTGT TTTTGTTTCGGCTAAAAAAGTCACTGGGTGAACATGGGTACACCAATGTC GCCATGGAAGGGGCGGCTGCGCTCTCACCACGCGACCCCTCAAATTTTTC CCAAGAGGAGGCTCCCTTCCCAGACCAAGAACCTGGAGGAGAAAGAGAAG CTCCAAACATTGAAGAAGCCTCAAAGTTTGCCCAAGAGGAGGCTCCCTTC CCAGACCGAGAACCCAGAGGAGAAAGAGGAGCTCCAAACATCGAAGAAGC TGGCTGCCCCCAAGAAGACAGCGAGAGGTCACCACACTGGAGCTGCTGTA CAGCAGCCGAGGGCGCCCTTACGCCAGTCGTCGCGGCTCGCTGGAAGAGA CCTTGAGCATCCAATTGTGATAGATGATGATGTAAGCGGGGCAGGAGTTG CTCTTGCTTGATTTATGTTTTTCCTACTAGTACCATCCATTTCCTTCCTG AATGTTAATCATGTCTGTTAGTTAGAAGCTTGATTCGTTTCATACTTGAT TCATAGATTATGAGAAATAGCATTGTAATTTGAACTTCCTCTTGTAGGAA CATAAAGCCAGGGCTGATCAATCAGCAATTACGCCTCTTCGCAGATCCCC ACGATTCCATGTGGAAGATAAGAGTTTGGGCAAGTCACTGTTGCCACCAA ATCGGCGGGAGACCTCTGCTAACAGAAAGACTAAAACAGCTCATAGGAAA GACAAAAATCAAGAGAGCCTGAAAAGGAATAGGGGAAGTGCTGGATTTCC TCCTAGGAAAGATATTTCAGATGTATCTAACAAAAAGAGTGACAAGCAAG AGTTAAAGTCCAATCATTGTAAAGTTCAGACAGGAAAGAGGAAGAGAGGA ACAGAAAGGAGGGTTTCATCGAAGAAGCAAAGTTGCCAGGACCCCGAACC ATTGCCTGTGTATTGCCAAGAAATTGCACCTCGCAATGTACCCATAAAAT CCACCCACAGAAGGATTGAAAAGGACCCTTCTATTGAGGTGAAGCTTAAA GTTGGTGATGAGAGGTTGAACATTGATGAAAACATCAACAAGCCAAGTGG GACTGAGAGAAAAGGAACTGGAAATTTTTGTGGTTCTGATGATTGGACAA AAGAGCAGGACATGGTATTGCGCAAAGCTTACTTCAGTGCCCGACCATCC CCACATTTCTGGAAGAAAGTTTCAAAAATGGTACCTAGTCTTTACATTAT TAATGTTCTATGGAACTAAGTTTTTTGCTGATCAATTTGGTTCCTTTTCT TCTGGTATATACAAAGATTCTAATGCACTATTTTAGTAGAAACAATATCT CATACATCATTAAGTTTCAATAACAGTTCATTCCTTTTTTTTCATAGTGT ACAGATTTGCTAATTCCGTTAACAAAAGGATATGATTAGACAGATTCAAA TAATAAAACATCTTAGAAAAAAGATGAATAGCTGGTGGTCACAATTCATC AAATTTACCATTAAAAAAATAATTGCAGAAATGTAAAAACTTGGGGACTA ATGGGCTTGATCGCACAATCAAAAGATCCTGAGGTTTCATAGTGCTAGTT TGCTTTTCTTTTTCATACTTCACTGGAATATTTCAGTGGTAGGTCCTATT TCTTATCCGGCATATTTCTTCTTTTATGTGTGGATATCTCCCTTTGTCAT TTATTAGCTGAGTGATTTTTGACACAACTCTTTTCAGGTGCCAGGGAGAT CTGCTGAAGACTGCTTCAACAGAATATATTCTGACCTCTCAACACCGACT CCAATTGGCCCACGTTCCAGAACAAGTAAAACAACATATTCTCCTATAGG AAATTTCACACTGTCTGATCCAAAACTTTCAAATATCTTGGAACCTACAG TCGGAAGGCGAAAGACTGCTAAACAAAAGAGTCTAGTAGCACAGAAGACA GTGAAGCATCTGTTGCAGAAGCATTGCCGCATTGACCAAGCTCAAGAGGC TGACCACTTCTCAATTTTTGAAAGCTCACCAAGTGCCTTACAATTGAACT TATCTTTTGAAGATTCTCCTGGGACTCCTGACAGTTGTATGAATTCAGCT TCTCTAGGAAAGCGTAGTGGAAGTTCTTCAGCACGAAAGAAACCATTTTC AAGGTTAAGAACTAAGCCATCTGAACCGAGCCCATCAGTTCTAAAGCCTA TAAAGAATGTTATCTTACATGAGAAGTACATTGATCAATTGGCACGTAGA GAAGGCACAAAAAGGCCTCGCAGAAGGACTCCAGCAGGCTCTAAAGCTGC TGGTTCTGGGAATTCTCTTTCTGAGCAGCAAGCTGGTAGTGTGAAGGCTG CTAAAAATGCTCTCATCTCAGAAGCAACCGACTTCATAAGCAGTTTTAAG ACGCTGCAAGCCGATTCCCTTGCGCATGTTGTGGAGAATAGTGAAGACGA GATTGAATGTGATGCCAGTGATTGTAGCCATGATGATAAAGAATAA
back to top

Coding sequence (CDS) from alignment at Sh_008G08:1..2746+

>Sh_008G08_t000010 ID=Sh_008G08_t000010|Name=Sh_008G08_t000010|organism=R570 Sugarcane cultivar|type=CDS|length=1753bp|location=Sequence derived from alignment at Sh_008G08:1..2746+ (R570 Sugarcane cultivar)
TCACTGGGTGAACATGGGTACACCAATGTCGCCATGGAAGGGGCGGCTGC
GCTCTCACCACGCGACCCCTCAAATTTTTCCCAAGAGGAGGCTCCCTTCC
CAGACCAAGAACCTGGAGGAGAAAGAGAAGCTCCAAACATTGAAGAAGCC
TCAAAGTTTGCCCAAGAGGAGGCTCCCTTCCCAGACCGAGAACCCAGAGG
AGAAAGAGGAGCTCCAAACATCGAAGAAGCTGGCTGCCCCCAAGAAGACA
GCGAGAGGTCACCACACTGGAGCTGCTGTACAGCAGCCGAGGGCGCCCTT
ACGCCAGTCGTCGCGGCTCGCTGGAAGAGACCTTGAGCATCCAATTGTGA
TAGATGATGATGAACATAAAGCCAGGGCTGATCAATCAGCAATTACGCCT
CTTCGCAGATCCCCACGATTCCATGTGGAAGATAAGAGTTTGGGCAAGTC
ACTGTTGCCACCAAATCGGCGGGAGACCTCTGCTAACAGAAAGACTAAAA
CAGCTCATAGGAAAGACAAAAATCAAGAGAGCCTGAAAAGGAATAGGGGA
AGTGCTGGATTTCCTCCTAGGAAAGATATTTCAGATGTATCTAACAAAAA
GAGTGACAAGCAAGAGTTAAAGTCCAATCATTGTAAAGTTCAGACAGGAA
AGAGGAAGAGAGGAACAGAAAGGAGGGTTTCATCGAAGAAGCAAAGTTGC
CAGGACCCCGAACCATTGCCTGTGTATTGCCAAGAAATTGCACCTCGCAA
TGTACCCATAAAATCCACCCACAGAAGGATTGAAAAGGACCCTTCTATTG
AGGTGAAGCTTAAAGTTGGTGATGAGAGGTTGAACATTGATGAAAACATC
AACAAGCCAAGTGGGACTGAGAGAAAAGGAACTGGAAATTTTTGTGGTTC
TGATGATTGGACAAAAGAGCAGGACATGGTATTGCGCAAAGCTTACTTCA
GTGCCCGACCATCCCCACATTTCTGGAAGAAAGTTTCAAAAATGGTGCCA
GGGAGATCTGCTGAAGACTGCTTCAACAGAATATATTCTGACCTCTCAAC
ACCGACTCCAATTGGCCCACGTTCCAGAACAAGTAAAACAACATATTCTC
CTATAGGAAATTTCACACTGTCTGATCCAAAACTTTCAAATATCTTGGAA
CCTACAGTCGGAAGGCGAAAGACTGCTAAACAAAAGAGTCTAGTAGCACA
GAAGACAGTGAAGCATCTGTTGCAGAAGCATTGCCGCATTGACCAAGCTC
AAGAGGCTGACCACTTCTCAATTTTTGAAAGCTCACCAAGTGCCTTACAA
TTGAACTTATCTTTTGAAGATTCTCCTGGGACTCCTGACAGTTGTATGAA
TTCAGCTTCTCTAGGAAAGCGTAGTGGAAGTTCTTCAGCACGAAAGAAAC
CATTTTCAAGGTTAAGAACTAAGCCATCTGAACCGAGCCCATCAGTTCTA
AAGCCTATAAAGAATGTTATCTTACATGAGAAGTACATTGATCAATTGGC
ACGTAGAGAAGGCACAAAAAGGCCTCGCAGAAGGACTCCAGCAGGCTCTA
AAGCTGCTGGTTCTGGGAATTCTCTTTCTGAGCAGCAAGCTGGTAGTGTG
AAGGCTGCTAAAAATGCTCTCATCTCAGAAGCAACCGACTTCATAAGCAG
TTTTAAGACGCTGCAAGCCGATTCCCTTGCGCATGTTGTGGAGAATAGTG
AAGACGAGATTGAATGTGATGCCAGTGATTGTAGCCATGATGATAAAGAA
TAA
back to top