Sh_008G08_t000020

Overview
NameSh_008G08_t000020
Unique NameSh_008G08_t000020
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1401
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_008G08contigSh_008G08:23884..26144
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteProtein HYPER-SENSITIVITY-RELATED 4
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_008G08_g000020Sh_008G08_g000020R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_008G08_p000020Sh_008G08_p000020R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_008G08_t000020 ID=Sh_008G08_t000020|Name=Sh_008G08_t000020|organism=R570 Sugarcane cultivar|type=mRNA|length=1401bp
ATGTCGTCGGACGGGAGCGGGAGCGGGAGCTACGAGAGGTACATCACGAT
GGCCGCGTCGGCGGTGGCGGCGGTCATGCTGGTGCGGACCGTGGTGAGCG
AGCTGCTGCCCTACGAGGTCGGGGACCTGCTGCGCGCGGCGGCGCGGGGC
GTCCGCGCCCGCGTCTCGTCGCGGCACACCGTGGTCATCAGCGAGGCCGA
GGGCCTGTCGGCCAACCAGCTCTACGACGCCGCGCGCACGTACCTGGCCG
CCCGGGTCACCCCCGACGTGCCGCGCCTCCGCGCCAGCAGCGTCGACGAC
GCGCAGGGCATCACCGTGGGGATGGAGCAGGGGGAGGAGATGGTCGACGC
CCACGACGGCGTCGACTACACCTGGACCCTCGTCGTCTCCCGCGACGCCG
CAGCATCCAGGGCTGCAGGCGCCGCCGCCAGCCGCGACAAGGCCGGCCGC
CCGGAGGCCAGGTCGTTCGAGGTCAGCTTCCACAGGAGGCACAAGGACAA
GGCCCTGGGATCCTACCTCCCGCACATCGTCGCCACGGCCAAGGCCATCA
AGGACCGGCAGCGGAGCCTCAAGATGCACATGGTGGAGTACGACGCCTGG
ACCGCCGTCGACCTCCGCCACCCTTCCACCTTCGACACGCTCGCCATGGA
CGACAAGCTCAAGAGCTCCGTCATCGAGGACCTCCAGAGGTTCGTCAGGA
GGAAGGACTACTACCGGAGGATCGGCAGGGCCTGGAAGCGGGGCTACCTG
CTCTACGGCCCGCCGGGGACCGGCAAGTCCAGCCTCGTCGCCGCCATGGC
CAACTTCCTTAAGTTTGACATCTACGACCTCGAGCTCACCGAGGTCAAGT
CCAACTCCGACCTCCGGAGGCTGCTCGTCGGGACCAGCAACCGCTCCATT
CTCGTGGTCGAAGACATTGACTGCAGCATTGAGCTGCAACAGCGGGATGA
AGGCGAGAGGCGTGCCACCACCAGGCCCACTGCGTCTGCAGGAGAAGAAA
ACGACGACAAGGTGACGCTATCTGGCCTGCTCAACTTCGTTGATGGTCTC
TGGTCAACAAGTGGGGAGGAGAGGATCATCGTCTTCACCACCAACTACAG
GGAGCGGCTTGACCCAGCGCTACTGCGGCCTGGAAGGATGGACATGCACA
TCCACATGGGGTACTGCACCCCCGAGTCGTTCCGGATACTGGCAAGGAAC
TACCACTCAGTTGAAAATCATGTCATGTACCCAGAAATTGAGCAGCTTAT
ACAGGAGGTAATGGTCTCACCTGCGGAGGTTGCTGAGGTTCTGATGAGGA
ACGACAACAGTGATGTTGTACTCCAGGATCTCCTTGAGATCCTCAAGGAG
AAGAGGAAACAATCTGGTCAGAGCAAGGATGCAAATGAGAATGGAGATTA
A
back to top

protein sequence of Sh_008G08_p000020

>Sh_008G08_p000020 ID=Sh_008G08_p000020|Name=Sh_008G08_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=467bp
MSSDGSGSGSYERYITMAASAVAAVMLVRTVVSELLPYEVGDLLRAAARG
VRARVSSRHTVVISEAEGLSANQLYDAARTYLAARVTPDVPRLRASSVDD
AQGITVGMEQGEEMVDAHDGVDYTWTLVVSRDAAASRAAGAAASRDKAGR
PEARSFEVSFHRRHKDKALGSYLPHIVATAKAIKDRQRSLKMHMVEYDAW
TAVDLRHPSTFDTLAMDDKLKSSVIEDLQRFVRRKDYYRRIGRAWKRGYL
LYGPPGTGKSSLVAAMANFLKFDIYDLELTEVKSNSDLRRLLVGTSNRSI
LVVEDIDCSIELQQRDEGERRATTRPTASAGEENDDKVTLSGLLNFVDGL
WSTSGEERIIVFTTNYRERLDPALLRPGRMDMHIHMGYCTPESFRILARN
YHSVENHVMYPEIEQLIQEVMVSPAEVAEVLMRNDNSDVVLQDLLEILKE
KRKQSGQSKDANENGD*
back to top

mRNA from alignment at Sh_008G08:23884..26144-

Legend: polypeptideexonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_008G08_t000020 ID=Sh_008G08_t000020|Name=Sh_008G08_t000020|organism=R570 Sugarcane cultivar|type=mRNA|length=2261bp|location=Sequence derived from alignment at Sh_008G08:23884..26144- (R570 Sugarcane cultivar)
ATGTCGTCGGACGGGAGCGGGAGCGGGAGCTACGAGAGGTACATCACGAT GGCCGCGTCGGCGGTGGCGGCGGTCATGCTGGTGCGGACCGTGGTGAGCG AGCTGCTGCCCTACGAGGTCGGGGACCTGCTGCGCGCGGCGGCGCGGGGC GTCCGCGCCCGCGTCTCGTCGCGGCACACCGTGGTCATCAGCGAGGCCGA GGGCCTGTCGGCCAACCAGCTCTACGACGCCGCGCGCACGTACCTGGCCG CCCGGGTCACCCCCGACGTGCCGCGCCTCCGCGCCAGCAGCGTCGACGAC GCGCAGGGCATCACCGTGGGGATGGAGCAGGGGGAGGAGATGGTCGACGC CCACGACGGCGTCGACTACACCTGGACCCTCGTCGTCTCCCGCGACGCCG CAGCATCCAGGGCTGCAGGCGCCGCCGCCAGCCGCGACAAGGCCGGCCGC CCGGAGGCCAGGTCGTTCGAGGTCAGCTTCCACAGGAGGCACAAGGACAA GGCCCTGGGATCCTACCTCCCGCACATCGTCGCCACGGCCAAGGCCATCA AGGACCGGCAGCGGAGCCTCAAGATGCACATGGTGGAGTACGACGCCTGG ACCGCCGTCGACCTCCGCCACCCTTCCACCTTCGACACGCTCGCCATGGA CGACAAGCTCAAGAGCTCCGTCATCGAGGACCTCCAGAGGTTCGTCAGGA GGAAGGACTACTACCGGAGGATCGGCAGGGCCTGGAAGCGGGGCTACCTG CTCTACGGCCCGCCGGGGACCGGCAAGTCCAGCCTCGTCGCCGCCATGGC CAACTTCCTTAAGTTTGACATCTACGACCTCGAGCTCACCGAGGTCAAGT CCAACTCCGACCTCCGGAGGCTGCTCGTCGGGACCAGCAACCGCTCCATT CTCGTGGTCGAAGACATTGACTGCAGCATTGAGCTGCAACAGCGGGATGA AGGCGAGAGGCGTGCCACCACCAGGCCCACTGCGTCTGCAGGAGAAGAAA ACGACGACAAGGTTAGAATGATGTTACTATTCCATTTCCATCCACCAGTT AGAATCATAATATATAGGCTGTGTTTTGTTTCACCAAAAAAGCACTATGC AAAAAAAAATTCACCGTCACATCAAACTTGCGATACATGCATGGAGTACT AAATGTAGATGAAATTAAAAACTAATTGTACAGTTTGGTTGTACTTTGCG AGACGAACGTTTTGAACCTAATTAGTCAACGATTGGACACTATTTGTCAA ATAAAACCAAAACGTGCTACAATACATTTTTTTCCTCTTTTCAGGGAACT AAACACACACATAGCCACAAATTATTTACAGTACTGATTCTGGTCACAAA AACTAGGTTAAGATTTGGCCAAACCTAATAAACTACAAACATTAATAACT AGTACTATATAGTATAGTATCGCATTGTTTAGTTTGGAAGCACGATGTTC TTTAAGGATTTTAAGAACATATACTACCTCCGTCCAGAAAGGATACAATT TCAGAATAATGTTCAGTCAAAAGCCCCTCTTTTAAGTTTAACTAAATTTA TATTGAAACTTGAAAGACAGTAACATTAAATGTATTATCATTGGATTTGT CATGGAATAGATTTTTCATAATATACCTATTGAAGTTATAAATATTAATA CTATTTTCTGGGGCTCGAACCAAACCTAGAATTTTCCATTCCTGGACAGA GGGATTATTCTAGAAGAAATTGGTGGTCAAAGATAATCATCAAAAACCGT GCAGAGTCAAATATGTTAAATACGTATTTGTGAACAGAGGTAGTAGATGT CATGCATTTGTCGATTGGGCAGCTTTAGTTTCTTACCAGCGCTATTTGCT GGGAATTTTGGTGAACTGCAGGTGACGCTATCTGGCCTGCTCAACTTCGT TGATGGTCTCTGGTCAACAAGTGGGGAGGAGAGGATCATCGTCTTCACCA CCAACTACAGGGAGCGGCTTGACCCAGCGCTACTGCGGCCTGGAAGGATG GACATGCACATCCACATGGGGTACTGCACCCCCGAGTCGTTCCGGATACT GGCAAGGAACTACCACTCAGTTGAAAATCATGTCATGTACCCAGAAATTG AGCAGCTTATACAGGAGGTAATGGTCTCACCTGCGGAGGTTGCTGAGGTT CTGATGAGGAACGACAACAGTGATGTTGTACTCCAGGATCTCCTTGAGAT CCTCAAGGAGAAGAGGAAACAATCTGGTCAGAGCAAGGATGCAAATGAGA ATGGAGATTAA
back to top

Coding sequence (CDS) from alignment at Sh_008G08:23884..26144-

>Sh_008G08_t000020 ID=Sh_008G08_t000020|Name=Sh_008G08_t000020|organism=R570 Sugarcane cultivar|type=CDS|length=1401bp|location=Sequence derived from alignment at Sh_008G08:23884..26144- (R570 Sugarcane cultivar)
ATGTCGTCGGACGGGAGCGGGAGCGGGAGCTACGAGAGGTACATCACGAT
GGCCGCGTCGGCGGTGGCGGCGGTCATGCTGGTGCGGACCGTGGTGAGCG
AGCTGCTGCCCTACGAGGTCGGGGACCTGCTGCGCGCGGCGGCGCGGGGC
GTCCGCGCCCGCGTCTCGTCGCGGCACACCGTGGTCATCAGCGAGGCCGA
GGGCCTGTCGGCCAACCAGCTCTACGACGCCGCGCGCACGTACCTGGCCG
CCCGGGTCACCCCCGACGTGCCGCGCCTCCGCGCCAGCAGCGTCGACGAC
GCGCAGGGCATCACCGTGGGGATGGAGCAGGGGGAGGAGATGGTCGACGC
CCACGACGGCGTCGACTACACCTGGACCCTCGTCGTCTCCCGCGACGCCG
CAGCATCCAGGGCTGCAGGCGCCGCCGCCAGCCGCGACAAGGCCGGCCGC
CCGGAGGCCAGGTCGTTCGAGGTCAGCTTCCACAGGAGGCACAAGGACAA
GGCCCTGGGATCCTACCTCCCGCACATCGTCGCCACGGCCAAGGCCATCA
AGGACCGGCAGCGGAGCCTCAAGATGCACATGGTGGAGTACGACGCCTGG
ACCGCCGTCGACCTCCGCCACCCTTCCACCTTCGACACGCTCGCCATGGA
CGACAAGCTCAAGAGCTCCGTCATCGAGGACCTCCAGAGGTTCGTCAGGA
GGAAGGACTACTACCGGAGGATCGGCAGGGCCTGGAAGCGGGGCTACCTG
CTCTACGGCCCGCCGGGGACCGGCAAGTCCAGCCTCGTCGCCGCCATGGC
CAACTTCCTTAAGTTTGACATCTACGACCTCGAGCTCACCGAGGTCAAGT
CCAACTCCGACCTCCGGAGGCTGCTCGTCGGGACCAGCAACCGCTCCATT
CTCGTGGTCGAAGACATTGACTGCAGCATTGAGCTGCAACAGCGGGATGA
AGGCGAGAGGCGTGCCACCACCAGGCCCACTGCGTCTGCAGGAGAAGAAA
ACGACGACAAGGTGACGCTATCTGGCCTGCTCAACTTCGTTGATGGTCTC
TGGTCAACAAGTGGGGAGGAGAGGATCATCGTCTTCACCACCAACTACAG
GGAGCGGCTTGACCCAGCGCTACTGCGGCCTGGAAGGATGGACATGCACA
TCCACATGGGGTACTGCACCCCCGAGTCGTTCCGGATACTGGCAAGGAAC
TACCACTCAGTTGAAAATCATGTCATGTACCCAGAAATTGAGCAGCTTAT
ACAGGAGGTAATGGTCTCACCTGCGGAGGTTGCTGAGGTTCTGATGAGGA
ACGACAACAGTGATGTTGTACTCCAGGATCTCCTTGAGATCCTCAAGGAG
AAGAGGAAACAATCTGGTCAGAGCAAGGATGCAAATGAGAATGGAGATTA
A
back to top