Sh_009H11_p000010

Overview
NameSh_009H11_p000010
Unique NameSh_009H11_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length194
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_009H11contigSh_009H11:2523..3373
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR007033
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_009H11_t000010Sh_009H11_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_009H11_p000010 ID=Sh_009H11_p000010|Name=Sh_009H11_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=194bp
MTLERAVLAASSEPATTTQQGDQMECSGKEQQMQIVCVRSASTGAAVVGE
EVVEWAEEQSSRSALSLFKEKEEEIERKKLEVRDKVFSMLGRVEEETKRL
AFIRQELELMADPTRREVDAIRKRIDKVNKQLKPLAKTCLKKEKEYKMCL
EAYNEKSNEKATLVNRLMELVSESERLRMKKLEELNKTIESLY*
back to top