Sh_009H11_p000040

Overview
NameSh_009H11_p000040
Unique NameSh_009H11_p000040
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length604
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_009H11contigSh_009H11:31247..41813
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC3.5.3.23
InterProIPR008928
InterProIPR024746
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_009H11_t000040Sh_009H11_t000040R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_009H11_p000040 ID=Sh_009H11_p000040|Name=Sh_009H11_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=604bp
MGIAEVALHTMPGAFTTHSPASILSLGAVARRRNRNTNSVPNARALQGLL
RIPRLRSVRRLCQRIDDLARVTEGNGTWVKDAMNKAGQVLGDISVPGQVV
GGNGGLNGSAAKPPPQRRKSSSVEDEAWELLQESMVYYCGSPVGTIAAND
PNDSDPVNYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTM
DCHSPGQGLMPASFKVRTIPLDGDEDATEEVLDPDFGEAAIGRVAPVDSG
LWWIILLRAYGKCSGDMSVQERIDVQTGMKMILKLCLADGFDMFPTLLVT
DGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLTPEDGSADLIRALNNR
LIALSFHIREYYWLDMQKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLV
EWIPPKGGYFIGNLQPAHMDFRFFSLGNLWSIVSSLATTQQSHAILDLIE
SKWSDLVAEMPLKICYPALENQEWKIITGSDPKNTPWSYHNGGSWPTLLW
QLTVACIKMNRPELAAKAIEVAERRIATDKWPEYYDTKKARFIGKQARLY
QTWSIAGFLVAKLLIEKPDAARILWNDEDAEILNALSTNRKRGKKVLKRT
YIV*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003824catalytic activity
GO:0033926glycopeptide alpha-N-acetylgalactosaminidase activity