Sh_009H11_p000080

Overview
NameSh_009H11_p000080
Unique NameSh_009H11_p000080
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length112
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_009H11contigSh_009H11:69455..70436
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR006121
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_009H11_t000080Sh_009H11_t000080R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_009H11_p000080 ID=Sh_009H11_p000080|Name=Sh_009H11_p000080|organism=R570 Sugarcane cultivar|type=polypeptide|length=112bp
MAAETVVLKVAMSCEGCAGAVRRVLSKMEGIETFDIDLKEQKVTVKGNVK
PEDVFQTVSKSGKKTSYWEGEATAPDASAPAAAEAAPNTAAEAPADASAA
VPEITPAKADA*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0046872metal ion binding
Vocabulary: Biological Process
TermDefinition
GO:0030001metal ion transport