Sh_009H11_p000100

Overview
NameSh_009H11_p000100
Unique NameSh_009H11_p000100
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length158
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_009H11contigSh_009H11:84920..85800
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR010404
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_009H11_t000100Sh_009H11_t000100R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_009H11_p000100 ID=Sh_009H11_p000100|Name=Sh_009H11_p000100|organism=R570 Sugarcane cultivar|type=polypeptide|length=158bp
MTVEDLVPAWKEHGLPFFMRHNHLVSMHSISCIHIYTVYLWCLGYRRASD
HHTLVTVWPVENVAYMKGSTPPEGFPNNWNGASYCTSDLSIHKNGEVHIW
DKGFDDEGNQVWGTKVGPYEFKPAPKSKYDDMFSPLNFSAPLSLEKKLDK
AYVIDDQ*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016829lyase activity
Vocabulary: Biological Process
TermDefinition
GO:0017009protein-phycocyanobilin linkage