Sh_009H11_p000110

Overview
NameSh_009H11_p000110
Unique NameSh_009H11_p000110
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length72
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_009H11contigSh_009H11:85878..87442
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_009H11_t000110Sh_009H11_t000110R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_009H11_p000110 ID=Sh_009H11_p000110|Name=Sh_009H11_p000110|organism=R570 Sugarcane cultivar|type=polypeptide|length=72bp
FLGTQWSEALSEGRFTGWTKFYMVKPCPKEMKCDVELSSYAIRDAEEYKN
FCDRQKDQRPQPEEVIAPLVF*
back to top