Sh_009H11_t000020

Overview
NameSh_009H11_t000020
Unique NameSh_009H11_t000020
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length570
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_009H11contigSh_009H11:4286..12283
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
Note1,4-alpha-glucan-branching enzyme 2, chloroplastic/amyloplastic
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_009H11_g000020Sh_009H11_g000020R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_009H11_p000020Sh_009H11_p000020R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_009H11_t000020 ID=Sh_009H11_t000020|Name=Sh_009H11_t000020|organism=R570 Sugarcane cultivar|type=mRNA|length=570bp
ATGATTAGACTTATCACAATGGGTTTAGGAGGAGAGGGCTATCTTAATTT
CATGGGAAATGAGTTTGGACATCCTGAATGGATAGATTTTCCAAGAGGTC
CGCAAAGACTTCCAAGTGGTAAGTTCATTCCAGGGAATAATAACAGTTAT
GACAAATGCCGTCGAAGATTTGACCTGGGTGATGCAGACTATCTTAGGTA
TCATGGTATGCAAGAGTTTGATCAGGCAATGCAACATCTTGAGCAAAAAT
ATGGATTCATGACGTCCGATCACCAGTATATTTCTCGGAAACATGAGGAG
GATAAGGTGATAGTGTTCGAAAAGGGAGATTTGGTATTTGTGTTCAACTT
CCACTGCAACAACAGCTATTTTGACTACCGTATTGGTTGTCGAAAACCTG
GGATGTATAAGGTGGTCTTGGACTCGGACGCTGGACTATTTGGTGGGTTT
GGCAGGATCCATCACGAGGCAGAGCACTTCACCACCGACTGTTCACATGA
TAACAGGCCCCATTCCTTCTCGGTTTATACACCAAGCAGAACCTGCGTCG
TCTATGCTCCAGCGGAATGA
back to top

protein sequence of Sh_009H11_p000020

>Sh_009H11_p000020 ID=Sh_009H11_p000020|Name=Sh_009H11_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=190bp
MIRLITMGLGGEGYLNFMGNEFGHPEWIDFPRGPQRLPSGKFIPGNNNSY
DKCRRRFDLGDADYLRYHGMQEFDQAMQHLEQKYGFMTSDHQYISRKHEE
DKVIVFEKGDLVFVFNFHCNNSYFDYRIGCRKPGMYKVVLDSDAGLFGGF
GRIHHEAEHFTTDCSHDNRPHSFSVYTPSRTCVVYAPAE*
back to top

mRNA from alignment at Sh_009H11:4286..12283-

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_009H11_t000020 ID=Sh_009H11_t000020|Name=Sh_009H11_t000020|organism=R570 Sugarcane cultivar|type=mRNA|length=7998bp|location=Sequence derived from alignment at Sh_009H11:4286..12283- (R570 Sugarcane cultivar)
GTGGGATAGCATTACATAAGATGATTAGACTTATCACAATGGGTTTAGGA GGAGAGGGCTATCTTAATTTCATGGGAAATGAGTTTGGACATCCTGGTGA GATTTAACTATTTTGTTTCATTTAACATTCTTTGAGTCTTGTTGAACAGT ACCTCATCTAACAATTATCTTGCAATTTATCTTTTGTTAGTTATATTGGT GTTGAGGACTTGAGGTCATTGTTCTACTTTCTATTTTGCAGAATGGATAG ATTTTCCAAGAGGTCCGCAAAGACTTCCAAGTGGTAAGTTCATTCCAGGG AATAATAACAGTTATGACAAATGCCGTCGAAGATTTGACCTGGTAAACTT TCTTTGAGCTATTGTGCTTGTGCATCAGTAAAGTCCAGTTTGTATTTACT TTTACCACTTATCGAGTGCTTTAATTAGCAAGGTGCCATTATAATAGTTC CTTCTTTATTCATATTAGTGTGTTTTCAAAATTAAAAATATTACTGCCTT TGCAAAATTTTGCTTTAATTTCTGTTGTTATGTTTGGTCAATAATTGGTC ATTATCGGAATTGTGTTATTTTTACATTGTCAGGGTGATGCAGACTATCT TAGGTATCATGGTATGCAAGAGTTTGATCAGGCAATGCAACATCTTGAGC AAAAATATGGAGTATGTTCTGTAATTATTTTTTGATTTGGTTCTGCAAGT TTGAGTTATTGTTTCTACTAACATCATACTTGGTGGGCATTCTACTTGTA ATGTCATTTCTAAAAACCATTTCTCTATTTTACTGAGCTTTTAAGCTAGG AAAATTTTATTATGAATTCTTTGATGTTGCATCAGCAATTCTATTTCATG GTGCTTGATTTTAGCTGTCCTTTTGTCGCAATAATCTATGCTCTAGCTGA GTTGGTTAGGTGGCTTAAGTTCGACTCCCTGTGGGAGCAAATTTTAGGTT GGGGTTAAAAAAAACTGTTGAAAGTGGTTCTCTCATAATTAGGGCTAACC CTAGATGGGTAGCTATATAGGTTCCATACATGGGCCACATGGGCCTTAGC CTCATGGGCCTAAACACATACTCCAACACCCCCCGCAGTCTGAACTACCG ACGCAGCGGAGTTCGAGGCTGAACAAGAAAGAACACACACAACCCCCCAC AGACGCAACTAGCCACCGGTGATGTTGAGGCTGGAGCGAAACTCGGCGAA GGTCGAGGACGGGAGGCCTTTGGTGAAGATGTCCGCGAACTGGGAGGTCG TCGGAACATGAAGGACCCGCACCTCGCCCAAGGCCACCCGATCACGGACA AAGTGGAGGTCGATCTCCACATGCTTCGTCCGCTGGTGCTGGATGGGGTT GGTGGAGAGGTAGACCGCACTGACGTTGTCGCAGTAGATCAGTGTGCTCC GGGAGGGCGGAGTGTGTAACTCAGCAAGCAGCTGCCTGAGCCAGGCGGCC TCCGCCACGCCGTTAGCAACGGCGCGGTACTCCGCCTCGGCGCTGGACCG GGAGACCACCGGCTGGCGCTTGGATGACCAAGACACCAGGTTGCCGCCCA GGAAGACGGCGTAGCCGGAGGTGGAGCGGCGAGTATCCGGGCACCCGGCC CAGTCAGCGTCGGTGTAGACGACGAGGTCGGTGGAGGAGGCCCGGTGTAG GAGGCCATAGTCGAGCGTGCCCCGGAGGTAGCAGAGGAGGCGCTTGAGAG CCGTGAGGTGAGGCTCCCGGGGGTCATGCATATGAAGACAGACCTGCTGA ACTGCATAGGTGATGTCCGGTCGGGTGAAGGTGAGGTACTGAAGGGCCCC GGCGAGACTCCTGTACGCAGTGGGATCAGCCACCGGTGGTCCCTCATCCT CAGACAGCTTGCCCTGAGTGTCGACCGGAGTGGAGCAGGGCTTGCAGTCA GTCATCCCAGTCCGCTCCAGGATATCCCGAGTGTACTGCCTCTGGTGAAG GAGTCCAGCAGGACGGTGCTCAACAGTGACACCGAGGAAGTGGTGGAGCT CACCCAGATCCTTCATCGCGAAATCCTGCTGGAGAGCTACAATGATCCGG CGGAGAAGTGGCTCGCTGGAGGCTGTGAGGACAATGTCATCAACATAGAG CAACAAGTATGCAGTGTCGGCCCCATGGTGGTAGACGAACAGGGACGTAT CAGACTTGGCCTCCACGAACCCCAGGGTCAGCGAGAAAGCAGCGAACCGG TGGTTCCACGCCCGAGGTGCCTGCTTGAGGCCGTAGAGGGACCTGTTGAG CCGGCAGACCATGTCAGGACGGGTGGTGTCGACGAACCCCGCCGGCTGAC TACAGTACACCGTCTCGGTAAGAAGGCCGTGGAGGAAGGCGTTCTTGACG TCCAGCTGGTGGACGGGCCAAGACCGAGCAAGTGCCAGCGATAGCACGGT ACGGACGGTGGCCGGCTTGACCACCGGGCTGAAGGTCTCATCGTAGTCGA CGCCAGGGCGCTGAGTGAAACCCCGGAGGACCCATCGAGCCTTGTAGCGC TCGAGAGAGCCGTCAGCCCGGCGCTTGTGGGTCCAAATCCACTTGCCGGT GACGACATTGGCGCCCGGCGGCCGGGGCACCAACTCCCACGTCTGGTTGG CGAGTAGCGCGGCGTACTCCTCTTCCATCGCGCGGCGCCAGTGAGGGTCC AATAGAGCATCGCGGACGGAAGAGGGTACCGGATAGACCACCGCGTCGCC GGTCGAAGCCTCGAGGACACGAGGCGGCAGTGTGCCAGCCGCGTGTCTGG TCACCATCGGGTGAACATGCCGCGGGTGTCGATGAAGTAGCGGCGGGTGG TAGACCGGCGGGGCACCACGAGCCGGCGGGGACTGCGGTGGTGGTGTCGG TGTCCCCGGTGGAGAAGGAAGCGCGAGCGGCGGCGGCCGCGGCCTGCGCT GGTACACCCGTACCGGCGCGGCGAACCTCGACGGAGGTGCCGGGGCAGGT GCCGGGACGGGATCCGGCGTTGGCAACCGACACGCCCCCCAGGGCAGAAG CGGGGGACGAAGGCCCCGGGTCTGCACAAACCGGAGATGACGGGCCCGGC CCCGCTGGGGATCCAGGACCGGGGGCCAGCCCGGCGTGCGGCGAAGCGGT ACCTGCAGGAGACCACGAAAAAGATGGCTGAACCACCGGGTCAGTGGAAA ACAGGGAGGGTGGTTCAGGTACCGGAGGGGTGGTAGTGCTGGAAAAGGGA AAGACGGACTCATCGAATACCACATGGCGAGATATGAGAACCCGTCGGGA GGTAAGGTCAAAGCACCGGTACCCCTTGTGATGCGGAGAGTACCCGAGGA AGACACAGAGCGTGGAGCGAGGGTCCAGCTTGTGGGAAGAAGTGGCAGCG GTGTTGGGATAACACGCACACCCAAACACGCGGAGGTGATCATACCGCGG CGGGGTACCGAAGAGGGCGTGGTGAGGAGTGGGAGCGGGGCAAGCCGCGG AAGAAAGGCGGTTAAGAAGATAGGTGGAGGTGTGCAGGCCCTCGGCCCAG AAGCGAGCAGGAAGAGAGGCCTGAAACAGAAGAGTACGCACGGTGTCGTT GGTAGTGCGAATCATCCGCTCTGCCTTGCCATTTTGCGAAGAGGTGTATG AGCAAGACATGCGCAACTGAACACCGTGAGAGAGGAAGAAAGCGCGGGAG GTGGAGTTATCAATCTCGCGACCATTGTCACACTGGACGGCCTTGATGGT GAGGCCGAACTGTGTAGACACCCACGTGAAGAAGTGAAGGAGCGTGGTAA ACATGTCTGACTTCGCACGGAGAGGAAATGTCCAAGAATAATGCGAAAAA TCATCAACAACCACAAGATAGTACTTATAACCAGAAATACTGAGAACAGG AGATGTCCATAGGTCGCAATGTACAAGATAAAAAATGCGGGCCGCATGAG AAGAAGAACTAGAAAAAGGAAGACGAACATGTCGGCCCAATTGGCACGCA TGACACAGTTGCTCATCATGAGCTCGAGTACATGGAAGACCAGAGCTACG ACTGAGCTGTATCAGGGCATCACGTCCAGGATGGCCGAGGGGCCGGTGCC AGGTAGTAGAGGAAGTAGAAGCGGCGAAGGCAGCTGACAAAAAGGACGGC GAAGAAGACGAAGGCGCCGCCGGGAAGCGAAGGGTGTAAAGGGGCCCGGT GCTGTCACATCGGAGCAGAGGACGCCGGGAAGCCAAATCCTTTACAGTAA GACCAGAAGAGTCAAATTCCACAGAACAAGAATTGTCAGTTGTAAAACGA CGAATAGAAAGAAGGTTATGAACCATAGAAGGAGCAACAAGAACATCAGG AAGACGAAAGGAGCCATGAGCACCGGTGGTACCCACAGACGTGACAGGAA GGCAAGAACCATTGGCGACCATAATGGATGAAGGAAGAGAGGAAGGAGAG TGGAGCGACGAAAGTATACCGGGGTCAGGAGTGGTGTGGTAGGTGGCTCC CGAATCAGCAATCCACTCAGGTCCGACCGGAGGTGTCAGGCCCATGGTGC TGAACGAGCGGGCCAGGGCCGCCGGGTCCCATCCGACGACCCCCGGAAGA GTCCCAGAGGGTGGAGTCCACGCCATAGCAGGGAAGACGCCGGGTGTAGG GCCAGCAGGATGAGCTCCGGTGAGCATGGCCACCGGTGGGCGCGAGTCGG CCCCGATGGCGTGGTAGGGCCACATGGAGATGCGCCCTGACCACGGGTAC TGGAAGGAGGGCCATGGTGCCCCCCTGCGGCCCACCAGGAGCCGGAGGCT AGGTGTGTCCGCCCCGGCCACCCCCGCGACCCCCTCCACGTCGACGGCGA CCGCCACGGCCCCCCACCTCTGCTCGGCCCGGAGGGAGGGGGACCCAGAA GAGACGGCGACGGTGGAGCGGCGGACCGTGGTGGAGCAGTCGAGCGCGGC GAAGTAGCAGCCAGGGCCGTCGAGGGGGACGAGGAGCCCGTGGAGGTGGT GGATCCCGGCTGGAGGCCCTGAGTGAGCTCCTCCATGACGAGATCGTCAC GGACCTCCAGGAAGGTGGGGAAGGGCCTCTGGCGGGTGATCCACGTCCGG AGGTGGGCGTAGCGGTCGCTGAGCCCCCGGAGGACGTTGAGGACCAAGAT GCGATCCTCCACGGGCCACCCAAGGTCACCCAGGGAGTCCGCCATGCCCT TCATCCGACGGCAGAACTCGCCGACGGAGAGGTCACCCTGGACGAAGGTC CTGAAACTCGCGTCGAGGCGCAGAGCCCGGGCCTCCGCGTTGCCTAGGAA CTGGCCCTCAAGGGCGAGCCAAGCCCGGCGCGCGTCAGGAGAGGTGCGGA CGAGGTCGTGGAGGTCCAGAGAGATCGTCCCCAGGATCCAGGAGAGGACG ATGCTGTCCAGACGAAGCCACGACGGGGTCTGGACGACGACTGAAGCGTC AACGAGGACGTGGTCGTCGAGGGCGTAGCGGCGAAGAGTGAGAAGCACCA GATCCCGCCAGCGGGCGTAGGAGGGCGACTCCGGCTCGAGGACGACCGGG ACGAGGAGGCGGATGTTCTAGACCCCCCCGGCCTGGTAGTAAAGCTGAGC CACTAGCGGGTCGGCCGGGTCGTGCCAGAGGACGGCAGTGTGGGACACGC GGCGTCCCGGCGAGGCAGAGGAGGTAGCTCCGGCGTCCTGGCCCACGGGA GAGTTGAGGAGATGCTCGGCCTCGGCGATCTGGCGAGCCAGGGCGTCAGC CGCGTCGCGCTCACGCTCCCAGACGGCAGCGGCCGCCCGCACACGAGCCT GCCCCTCCGCGGCGGCCGCGCGGGCAGTGACAAGGGTGGCGGCGAGGGCG GAGTCGGAACGCGGGCCCTGAAGCGTAGGCGTGCCGTCACCGGGAGGCAT GGCCGCCCGATGGAGGACGGCGGCATCGGTCCCGGCGGCGCGCAGGAGGG CGGCCAGGGCGGCTGGAAGTTGGTCAGCGCCCCCTGCCCCGGCAGCTGCA TCGAGAAGGGTGGTGAGGGTGGTCTGGAGGGTGTAAGCGCCGAGCCCCGC ATGGACCAGAGGAGAGCGGGCCGTCGGGAGAAGGGGATGCTCAACGCCGG TGGCCGCCGGAGCAGGGTCTTCCCCGCCGCCCGTGCCTGCAGCGTCCGCC CCGGCAGTGAGGGCTGCTGCCGTGTGGGTAGGGAGGGGGAGGGTCGTGGC AGGGAGGTGGGGCCCCGCGTGCGGCCTGGAGCACGGCAGCCAGGGGCGCG ACCCCGACGGGCGGAGTAGCGGGCGCGGCCCCAGGCGGCGCAGTAGCGGG CGGTGCCCCAGGAGCAGCGGCTGCAACCTGCGCCCAGGAAAGGGTGGGGG GGGGGGAAGGGAAGAGGGAGAAGAGGGAGGGAGAAGAGGGAGGCCGGTCA GCCATGCCGGCGCCGGTGGCAGGGGCAGCGCCGGCGGGAGGAGACTGAAC GGCGGCGGCTCAGGGTGGGGAAAGAGGAAAGAACAGGCTTGATACCATGT TGAAAGTGGTTCTCTCATAATTAGGGCTAACCCTAGATGGGTAGCTATAT AGGTTCCATACATGGGCCACATGGGCCTTAGCCTCATGGGCCTAAACACA TACTCCAACAAAATCCTCTCATGTGTCCCACGCCAATGCGCAGGTCTAAG GACCGACCCAGGTTCTCACATGGGCAACGGTGCCGCTGTGTATGGTTGCC TTCTATCTTAGACAGAATGCTTGGGGTTGTCTTACACCTCGTAGGTCAAG TTTTTAAACTTGGCAAATCTATCTTAGGTATTTCCATGCTCATTAGTAGT ACTCTGGACTCTTGATACAACACGCCATAACAGTAGCGAAAAATTTTCTG ATGAAACTTGCTGTATGATTGCAGTTCATGACGTCCGATCACCAGTATAT TTCTCGGAAACATGAGGAGGATAAGGTGATAGTGTTCGAAAAGGGAGATT TGGTATTTGTGTTCAACTTCCACTGCAACAACAGCTATTTTGACTACCGT ATTGGTTGTCGAAAACCTGGGATGTATAAGGTATGCATCTGTCGTGCATT CCCTATGCTCAAAGTGCCTACCTTTTCTTGCTAAATGAGTTTGCTATACG TAGTATCATGCTGCAATTTATCAAGTCTCTTTATTGTTCTCTTTCTATGA TGAAGCTAGGAGAAACTAAGCTGTTGGTGTCACTGTCAGCAATTCATGTT GTAGTTAATTTAATATGCTTGAAAAAGTAGGACACTAGATTTGGATTTTT CCATTTTGTTATGCCATACGAGCAGGTAAAAGGTAGCAAAATACTAGTGT CATACTTATATATATATAAAACAAAAATATGAACTGGGCGTACCTGTTAT GGATGGGGATGGCCGCATGCTCGTTCTCTTGGTGCCTCTGATATTGGAGC ACATCCGTTGTTCCAAAACTAGCTGGAGAACAGAAGTTTCTCAAAATCCA CTTGCTGAGGTGCTGACAGCATCTGCTATTTGTATCAGGTGGTCTTGGAC TCGGACGCTGGACTATTTGGTGGGTTTGGCAGGATCCATCACGAGGCAGA GCACTTCACCACCGTAAGTTTTGTGGCGCATGATATTGCTTTCGGTACGC AGATGTCAACTTGTTCCTGACAGAAGATGTGAGCTAACTTCTGTTACAAT ATTGGTCATTACCTGCAGGACTGTTCACATGATAACAGGCCCCATTCCTT CTCGGTTTATACACCAAGCAGAACCTGCGTCGTCTATGCTCCAGCGGAAT GATAGCAAGGTACTGGTTGCTGGGCGGCATGTGTGGGGCTGTCGATGTGA GGGAAAAAAAACATTCTGCCAACACCGGCAGATGCATGCTTGGCACAATA AGGTTCTGAAACTTCAATCGATGCTGGAAAGCCCAGACATCCTACTGCGT TGTCATCTCTAAATATTTAAGACCTTCAGGATGTCAATTAAACATAGCCT TGTCTTTCTTTTTCGTTTTTCCTAATGCCTGATGACTGATTGTTTGCGCT TGTTTCATTCCGTTGAGCACTGATGATCTTAGAGTTAAACAATCGACT
back to top

Coding sequence (CDS) from alignment at Sh_009H11:4286..12283-

>Sh_009H11_t000020 ID=Sh_009H11_t000020|Name=Sh_009H11_t000020|organism=R570 Sugarcane cultivar|type=CDS|length=570bp|location=Sequence derived from alignment at Sh_009H11:4286..12283- (R570 Sugarcane cultivar)
ATGATTAGACTTATCACAATGGGTTTAGGAGGAGAGGGCTATCTTAATTT
CATGGGAAATGAGTTTGGACATCCTGAATGGATAGATTTTCCAAGAGGTC
CGCAAAGACTTCCAAGTGGTAAGTTCATTCCAGGGAATAATAACAGTTAT
GACAAATGCCGTCGAAGATTTGACCTGGGTGATGCAGACTATCTTAGGTA
TCATGGTATGCAAGAGTTTGATCAGGCAATGCAACATCTTGAGCAAAAAT
ATGGATTCATGACGTCCGATCACCAGTATATTTCTCGGAAACATGAGGAG
GATAAGGTGATAGTGTTCGAAAAGGGAGATTTGGTATTTGTGTTCAACTT
CCACTGCAACAACAGCTATTTTGACTACCGTATTGGTTGTCGAAAACCTG
GGATGTATAAGGTGGTCTTGGACTCGGACGCTGGACTATTTGGTGGGTTT
GGCAGGATCCATCACGAGGCAGAGCACTTCACCACCGACTGTTCACATGA
TAACAGGCCCCATTCCTTCTCGGTTTATACACCAAGCAGAACCTGCGTCG
TCTATGCTCCAGCGGAATGA
back to top