Sh_009H11_t000040

Overview
NameSh_009H11_t000040
Unique NameSh_009H11_t000040
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1812
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_009H11contigSh_009H11:30883..42058
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteAlkaline/neutral invertase protein
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_009H11_g000040Sh_009H11_g000040R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_009H11_p000040Sh_009H11_p000040R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_009H11_t000040 ID=Sh_009H11_t000040|Name=Sh_009H11_t000040|organism=R570 Sugarcane cultivar|type=mRNA|length=1812bp
ATGGGGATCGCGGAGGTGGCTCTCCACACCATGCCGGGGGCGTTCACCAC
CCACTCCCCGGCATCCATTCTGTCCCTTGGGGCAGTCGCTAGGAGGAGGA
ACAGGAACACCAATTCGGTGCCCAACGCCAGGGCACTGCAAGGCCTCCTA
AGGATCCCGAGGCTGAGGTCCGTCAGGCGGCTGTGCCAGCGGATCGATGA
CCTTGCGAGGGTCACAGAGGGGAACGGGACTTGGGTAAAGGATGCCATGA
ATAAGGCCGGCCAGGTTCTTGGCGACATCAGCGTGCCTGGTCAGGTTGTA
GGTGGCAATGGTGGTCTAAATGGGAGTGCTGCCAAGCCTCCACCTCAGAG
GCGGAAGTCCTCATCGGTTGAGGATGAGGCCTGGGAACTTCTGCAGGAGT
CAATGGTTTACTATTGTGGTAGTCCTGTTGGGACGATTGCTGCAAACGAT
CCAAATGACAGTGATCCGGTGAACTACGATCAGGTATTTATTCGGGACTT
CATACCATCCGGCATTGCTTTTCTACTGAAGGGGGAATATGAAATTGTGC
GCAATTTCATTCTACACACCCTTCAGCTTCAGAGCTGGGAGAAGACAATG
GACTGCCATAGTCCAGGTCAAGGTTTAATGCCTGCCAGCTTCAAAGTGCG
GACAATTCCGCTTGATGGTGATGAGGATGCAACTGAGGAGGTCTTGGATC
CTGATTTTGGGGAGGCCGCAATAGGCCGCGTGGCACCTGTTGATTCAGGT
CTATGGTGGATCATATTGCTTAGGGCATATGGAAAATGTTCAGGGGATAT
GTCAGTACAGGAGAGAATTGATGTCCAGACTGGAATGAAAATGATTCTGA
AGCTTTGTTTAGCTGATGGTTTCGACATGTTCCCTACATTACTTGTAACT
GATGGTTCATGCATGATTGATCGTCGAATGGGAATCCATGGGCATCCACT
TGAAATTCAGGCACTCTTCTATTCAGCCCTCTTGTGTGCGCGTGAGATGT
TGACTCCAGAAGACGGATCAGCTGACTTAATCCGTGCCCTGAACAATAGA
CTTATTGCATTGTCCTTTCATATCAGGGAGTACTACTGGCTTGACATGCA
AAAATTGAATGAGATATATCGATATAAAACAGAAGAATATTCTTATGATG
CTGTCAACAAGTTCAACATATACCCCGATCAGATTTCTCCATGGCTTGTT
GAGTGGATACCTCCTAAGGGGGGTTACTTTATTGGAAACCTCCAGCCAGC
TCATATGGACTTCCGATTCTTTTCACTGGGAAATTTATGGTCAATAGTAA
GCAGCTTGGCAACAACTCAGCAGTCGCATGCCATTTTAGATCTTATTGAG
TCTAAATGGTCTGATTTAGTGGCAGAGATGCCACTAAAGATATGCTATCC
TGCTCTTGAGAACCAGGAATGGAAAATCATCACTGGGAGTGACCCTAAAA
ACACGCCTTGGTCGTACCACAATGGAGGATCCTGGCCAACATTACTGTGG
CAGCTCACTGTGGCATGCATCAAGATGAACAGACCAGAGCTTGCAGCCAA
AGCTATAGAGGTAGCTGAGAGGCGTATTGCTACAGACAAATGGCCTGAAT
ACTACGACACCAAGAAAGCACGCTTCATTGGGAAACAGGCACGGCTGTAC
CAAACGTGGTCTATTGCTGGGTTCCTAGTAGCCAAGCTACTGATAGAAAA
ACCAGACGCTGCTAGGATTCTGTGGAACGACGAGGATGCAGAAATCCTTA
ATGCTTTGAGCACAAACAGAAAACGGGGCAAGAAAGTGTTGAAGAGAACA
TACATTGTGTGA
back to top

protein sequence of Sh_009H11_p000040

>Sh_009H11_p000040 ID=Sh_009H11_p000040|Name=Sh_009H11_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=604bp
MGIAEVALHTMPGAFTTHSPASILSLGAVARRRNRNTNSVPNARALQGLL
RIPRLRSVRRLCQRIDDLARVTEGNGTWVKDAMNKAGQVLGDISVPGQVV
GGNGGLNGSAAKPPPQRRKSSSVEDEAWELLQESMVYYCGSPVGTIAAND
PNDSDPVNYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTM
DCHSPGQGLMPASFKVRTIPLDGDEDATEEVLDPDFGEAAIGRVAPVDSG
LWWIILLRAYGKCSGDMSVQERIDVQTGMKMILKLCLADGFDMFPTLLVT
DGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLTPEDGSADLIRALNNR
LIALSFHIREYYWLDMQKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLV
EWIPPKGGYFIGNLQPAHMDFRFFSLGNLWSIVSSLATTQQSHAILDLIE
SKWSDLVAEMPLKICYPALENQEWKIITGSDPKNTPWSYHNGGSWPTLLW
QLTVACIKMNRPELAAKAIEVAERRIATDKWPEYYDTKKARFIGKQARLY
QTWSIAGFLVAKLLIEKPDAARILWNDEDAEILNALSTNRKRGKKVLKRT
YIV*
back to top

mRNA from alignment at Sh_009H11:30883..42058+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_009H11_t000040 ID=Sh_009H11_t000040|Name=Sh_009H11_t000040|organism=R570 Sugarcane cultivar|type=mRNA|length=11176bp|location=Sequence derived from alignment at Sh_009H11:30883..42058+ (R570 Sugarcane cultivar)
TGGCGATAGGCGGCGAGCGCGGCCCAACGAAAGCGTCGTGGTCGGCCGGT AAGAGCTCCTTGCTTTCCTCCACGCGCTGCTCCTGCCGTTCCGCAAGCTT TGTTTGATCCCCTCCTCGTTGGACGAGATGAGAAAAAAGTTGCTGCCTTT TGTTCATGTGTTCCTGCATAGAAACTCCGGTTTTGCCCTCCATTGGAAAT TTTGGATTAATGACTTGCCACGCTTCGTCTTACTTCAAATTCGTTCGATT CTTGCTGGGTTGCTCTGATTAGATTTTTTTTTGGTATGAATGGTATCCAA CTGCTGCCAATTGTAGCCGTCACGCTTCTTGCAGACGCTCGGCGGGTTGG GGAACAAGGCGCCAATGGGGATCGCGGAGGTGGCTCTCCACACCATGCCG GGGGCGTTCACCACCCACTCCCCGGCATCCATTCTGTCCCTTGGGGCAGT CGCTAGGAGGAGGAACAGGAACACCAATTCGGTGCCCAACGCCAGGGCAC TGCAAGGCCTCCTAAGGATCCCGAGGCTGAGGTCCGTCAGGCGGCTGTGC CAGCGGATCGATGACCTTGCGAGGGTCACAGAGGGGAACGGGACTTGGGT AAAGGATGCCATGAATAAGGCCGGCCAGGTTCTTGGCGACATCAGCGTGC CTGGTCAGGTTGTAGGTGGCAATGGTGGTCTAAATGGGAGTGCTGCCAAG CCTCCACCTCAGAGGCGGAAGTCCTCATCGGTTGAGGATGAGGCCTGGGA ACTTCTGCAGGAGTCAATGGTTTACTATTGTGGTAGTCCTGTTGGGACGA TTGCTGCAAACGATCCAAATGACAGTGATCCGGTGAACTACGATCAGGTA TTTATTCGGGACTTCATACCATCCGGCATTGCTTTTCTACTGAAGGGGGA ATATGAAATTGTGCGCAATTTCATTCTACACACCCTTCAGCTTCAGGTAC TGTTCTTATCTTGCCATTTAAATATTATTTTTATGTTGTTTAGGTTTAGG GCCTTATGCCTATCATATGAATTACGATAATGTCAGTGCCAATTTTGACT GCCCAATAACCAATTTGATCCCAAGGCAAAGAATAACCAGTTACACCAAA TGATGCAGTCAATACAGCCAAAACCACGCATGTGACCCAAGTTAATTCAC GGGGTTTTTTAAATCTACCTGTGAGATACACACGAAATACGTGCAGGATC ATCATTATAACCATCATACTTGCTGACCATCGATGAACCGATTGGATTAA CCAACCAAAGTTGGCCTCCGTCATATGTAATATGCATTTAACTAATGTTC GAGAAAAAAAAATGCATTTAACTATCAAAAGAATTATACTCCCTCTGTTC CAAATTGTAAGTCATTTAGTTGTCCTAAGTCAAATTTCTTTAGTTTTGGA CAAGTTTATAAAAATGCACAAACATCTACAACATCAAACTACATTTATTA GATACATCATGAAATATACTTTGATAGTGCATTTATTTGATATTGCAGAT ATTAATATATTTTTGTATAAACTTGGTCAAAGTTAGACAAGTTTGACATA GAACAAAGCTAAAACAACTTAAAATTTGGAACGGAGGGAGTAGAGTTTAA TCTAACTATGGTAATTTAATCTTTGTGAACTTATTATCACTTTGGCATGT TGCTTTATATGTATTTGACTTGGCATATAAATGAAAAATGAGCAATGGCT CAGTTGGTGGAACCTCCAGTAGAGAGGCCTCTCACTAAGTCTGGAACCCA GGTGCTCACATGGTCATGTGAGTATCTCCTTAAAATGAATGGTACTCTCC TCTCTTAAGACAATGCCAGAGGATGCCTTCTTCGCATTGTCGGTTTTTGT TTTTTGGCATACAAATTTGTCTTGACGCTTCCAAATTTCAGCAAGTACAC CAGCGGTTAAGACTATCACCTAGGAGCTACAGAATATGTTGTCAGGAAAT ATGGTTACACACATGCCTTGGTAAAAGTTGATGTACAGTGACACGCGTAC TTGTTATTTTATTGTCTTTGAAAATTGGCATCCTATAGCTCAAGCAGTTT GTTGCTTTTAAATATATATAAATTGTTTCGGAAGGAAAAAAATACCATAA CTGTATGCACTTCCTAAGATGTGATATTTTGGGATATGACGCTCAATTAA ATGGCATTCATGTTTTCTGACTTTATTTCTCACTAACATGTGGCTGAACT TCACATACCAGTGAGACATAAAACTACAAAATCCTGAATTGCCACTAAAT TGAGTGACATGTCCTGAATTATTCCTCTGGATGTGACAGTTTGTCTGACA CCTTGAACTGGTCTATAGAGCTGGGAGAAGACAATGGACTGCCATAGTCC AGGTCAAGGTTTAATGCCTGCCAGCTTCAAAGTGCGGACAATTCCGCTTG ATGGTGATGAGGATGCAACTGAGGAGGTCTTGGATCCTGATTTTGGGGAG GCCGCAATAGGCCGCGTGGCACCTGTTGATTCAGGTACTGTTGATAATGG GGTTAGTTGTTTTTGTTTTGGTTACTCTGCATTCCCTACTTTAATTGGGT ACCTGATAAAAAATGAGTTTCAGGTCTATGGTGGATCATATTGCTTAGGG CATATGGAAAATGTTCAGGGGATATGTCAGTACAGGAGAGAATTGATGTC CAGACTGGAATGAAAATGATTCTGAAGCTTTGTTTAGCTGATGGTTTCGA CATGTTCCCTACATTACTTGTAACTGATGGTTCATGCATGATTGATCGTC GAATGGGAATCCATGGGCATCCACTTGAAATTCAGGTTTCCTTTTTGCTA CGCCTAGTTATATTTTCTGTTTCATATGGGTCCTTGTTTCTCGAGTTGAT TTTTGTTGTGATTTTTCGAGGCAACTTTATAAAAGAATGTAACACACAAA CCATCCTTAAAATTGTCTGGGGATGCCATCTAGGTTCCCTAGCCATTAAT TTGGAGTTTCACATCTCTGATCTTCCTAAATGGTTCACTCGGGATCCTAT CCTTCATAATCAGTTAGTCCATGGGCAGCCTACTTGGCAGCTCCTGACAT CATATTCTTTCATGTTCTCCCTCTTCCCCAACAACCCCCCCCCCCCCCAA GTCTTTCCTCCCTCCCTCCGTCCCTCTCTCTCTCTCAGCAGAGTCTTGTT AGCGTCCACGTCACCAGCCAAAGGGTTTACCCACAGGGTTTGCACCTTGG GTGTGATGGATAAGTCTCATGTGTGGTTGGTCTTTGTGGGGCTGTGCTGC TCACATGGTCCTTGTGGCTGTTTTTCTGTTTTTAGGACAACATCTTAGAC TAGAGGACAGCATCTTAGAGGACAGCATCTTAGACTAGAGGACAGCATCT TAGAGGACAGCATCTTAGACTAGAGGACAGCATCTTAGCTAGGACAGCAC TTTAGCATCTTAGACTAGCATCTTAGACTAGCATATTGGCATATGCTTGG CTGGCTAGCAGCCTATAAATATGTAACCCCAACCCCTCAGGTTGGCATGG CATTGTATGAGTTTGTGTGAGAAATAAACCAGAAAATTGTCCCAACTCCT AGTGTCATCCTCTCTCGATGAGAGTAAGGATTCAGCTACTACCAAGAGTG CGAATCCAGCGACTAACAAGTGGTATCAAAGCCGTACTATCCTGTAGCCT GAGCATCTCCTGCTCTTCTCCTTCCCCGGCCTCGCAGCAGCCCCAACCGC AGCCGGTAGCAGCAGCAGCTCCGGCTGCCCCTGCTCTCCACACAGCAGCC CCCTCGATAGCGCGCCATGTCCGCAGGCCAGTCTCAGGGCTCGGTCGCCT CGAGCGCGCGGCGTCGGCAGGAGGCCGACCTCGCCGCGGCAGAGAAGCGC GAGCGAGCGGCAGCAGACGCCGCTGCAGCATCGGCAAGGGCATCGAGGCT GGCAGCAGCGGAGCTAGCAGCAGCTAGAGCGGAGGTGGAAGCAGCGGCGG CGGCGGATGCAGCGCGTGCAGCAGCAGCGGAGGTCGAGGTTCTACGCGGC AGCAACAGCAGCTCCATCGCTGCTGATGATAGCGCCGACGCGGACCTCGA GCTGCTGGAGAGGGAGGCATCGCGAGGGCAAGCGGCGCAGTGGGCAGCCG TGCACGCCCACGAGCGCGGCGGCAGCCCAGACAGGCGCAGACACGCCGGC GGCGCTCCTGAAGGAGGCGCGCACGGCGGTGGCGCTCCTGGAGGAGGCGC GCATGGCGGCGGCGGACGGGTCGACGGAGAGCGCGGCCTTCACAGGCAGC GCGGCTCTCTCTCCCCGGTTCGGTACCGTGGTCACCACGAGTACCAGGCT GTCGTCAGGGACGTCGGCCCCGGCGGCGGGTGGCCTACCCTCACCAAGAC CAACTATGTTGAGTGGGCTGCGGTGATGAGGGTGAAGCTCCAGGTGCGGC ATATGTGGGATGCAGTCCGGTACGGCGACGTCGACTACGACCAAGATCGA CGGGCGCTGGATGCTCTCATTGCTGCAGTCCCGCCCGAGATGCAGTTTTC GCTTACCAGCAAGCGGACTGCCAAGGAGGCTTGGGACGCCATCGCTGCAG CACGCATCGGCAGCGACCGCGCCCGCAAGTCCACACTGCAGGCACTTCGC AAGGAGTGGGAGAACCTGGCCTTCAAGCCAGGTGAGGACGTTGATGACTT TGCTCTCCGTCTCAACACTCTGTTGCAGAAGTTGGTGCAGTTCGGCGACG ACACCTACGGCGAGGAGAGAGCTGTTGAGAAGCTCTTCCGCTGCGTCCCC GAGAAGTACAAGCAGATGGCTCGCTCAATCGAGTCTCTGCTGGACCTCTC CACGATGACGATCGAGGAGGCGTTGGGCCGCCTCAAGGTCGTTGACAGCG ATGAGCCACAGCGCCTCTCGGGACCCGTCACCATTGGCGGGAAGCTCCTC CTCACTCGGGAGCAGTGGGCTGCCGGCCAAGGTGACAGGAAGAAGGGGGA GCCTTCTTCCACGACAGGCAGCCGCAAGCGTGGCAAGCGTGGCAAGCCGC GCAAAGACGCCCAGGCAGGGGCGCGAGGACGTGCCGAGGGTGATGATCGT GGAGGCGCCCAGGGCGGCGCTGCTGGCAAGCAAAAGCCAGCACGAGGCGA CCCTTGCTACAACTGCGGCAAGCTTGGTCATTGGGCCAAGGATTGTCGAC AGCCACGACGCGGCCAGGCCCACGTCGCGCAGGCGGAGGAGGAGGAGCAG CCGGCTCTGTTCATTGCTCATGCGAGCATCGAACTACCTCCAGCGGCACC GGCCGCAACGGCTCTCCTCCACCTTGACGAGCCAAAAGCACACGCCCTCC TCGACGACAGCTCCGGCAACGACAAGGCCGACGGGTGGTGCCTTGACACC GGCGCCACCCACCACATGACCGGGCGGCGGGAGTTCTTCACCGAGCTCGA CCCAAGCGTTCGAGGCACCGTCAAGTTCGGCGACGCCTCCGCTGTGGAGA TCAAGGGCGTCGGCTCTGTCGTCTTCGTCGCCAAGACTGGCGAGCACAGG CTGCTCACCGGTGTCTACTACATCCCCGCGTTGAGGAACTCCATCATCAG CTTGGGACAGCTGGATGAGAGCGGATCGCGCGTGGAGATCGAGCACGGGG TGCTGCGCATCTGGGATCATCGACACCGGCTCCTGGTCAAGGTCAACAGG AGCAACCGCCTCTACGTCCTTCACGCACAGGTGGCGCAACCTCTTTGTCT TGCAGCCCGCCGCGACGACGACGCTTGGAGGTGGCACGAGCGCTTTGGGC ACCTCAACTTTGAGGTCCTAAGGCAGCTCGGCAGCAAGGACATGGTGCGG GGCATGCCGCACGTCGACCATGTGGAGCAGTTCTGCGACACCTGCGTCCT CACCAAGCTGCGGCGGCTCCCTTTCCCTCGCCAGGCAAGCTTCCGCGCCA AGGAGAAGCTAGAGCTCGTACACGGTGACCTCTGTGGCCCCGTGACACCG GCTACACCTGGAGGCCGACGCTACTTCCTCCTCCTTGTCGACGACATGTC CCGCTACATGTGGGCTGTCCTGCTCGACGCCAAGGCAGCCGCGGCGGACG CCATCAAGCGTCTTCAAGCTGCTGCGGAGGCGGAGTGCGGCCGCAAGCTT CGGGTCCTACGCACGGACAACGGCGGCGAGTTCACGGCGGCCGAGTTCGC AGCGTACTGCGCCGATGAGGGGATCCACCGCCACTTCTCCGCGCCGTACA CTCCGCAGCAGAACGGCGTAGTCGAGCGCCGCAACCAGACGGTGGTGGCC ACCGCCCGTGCCCTCCTCAAGCAGAGAGGGATGCCGGCGATCTACTGGGG TGAGGCGGTGATGACTGCCGTTCACTTGCTCAACCGCTCCCCCACCAAGG CCCTCGACGACAAGACGCCATACGAGGCCTGGCACGGGCGCAAGCCCGCG GTGAGCCACCTTCGCGTCTTCGGCTGCCTGGCCTTCGTCAAGGAGCTCAA CCACGTCGGCAAGCTCGACGACCGGAGCACGCCAGGGGTCTTCATCGGCT ACGCGGAGGGCTCCAAGGCCTACCGCGTCCTCGACCCTGCGACACGACGC GTGCGCATCACGCGTGACGTCGTGTTCGACGAGGGGCGAAGCTGGACGTG GGGCAAGATGGTGGATGATGGCTCGACTCCGACGACCAGCGATTTCGTCG TCGACTACGTCCACTTCAAGGAGGCGGGGGGAGCTAGCAGCTCGTCCTCA CCGAGCTCGCCTACCCCACCACCTCGTTCGCCACCACCCCCGGCGAGTCC TTCACCACCGCCACCACCAGCTCCGGCAAGTCCACAGGCTCCGGCGAGTC CACCACCAGCACCGCCGGCCACGCCTCGTTCTCCTACACTAGACCCTACC TCCTCAGGCTCGGCACCGGCAGCTTCGGCCCACGACGAGCAGCGCACAGT GGAGTTCGCCACTCCGCTGTCCAACGACGAGGATCGCATCGACGCCTACC ACGGCGGCGAGCCTCTGCGCTACCGTACCGTGGACAACCTCCTCGGCGAG CAGCCGGTCCCTGGACTGGCACAGCACGACTTTGAGGCGGAGCTGCACCT CGCACAGGACGATGGCGAGCCTCGTTCCTTCGCCGAGGCGGAGAGGGACG CGGCATGGCGTGCCGCGATGCAGATGGAGATGGACGCCGTCGAGCGGAAC AAGACGTGGGAGCTGGCCGATCTTCCAGCCGGCCACCACGCCATCTCTCT CAAGTGGGTCTTCAAGCTCAAGAAGGACGAGACCGGAGAGGTGATCAAGC ACAAGGCGCGTCTGGTGGCGCGCGGCTTCGTCCAGCAAGAAGGAATCGAC TTCGACGACGCCTTCGCGCCCGTTGCACGGATGGAGTCCGTGCGACTCCT CCTTGCGCTAGCTGCCCAGGAGGGCTGGCGTGTCCATCACATGGATGTCA AGTCGGCATTCCTTAACGGCGACTTGAAGGAGGAGGTCTACGTGCATCAG CCGCCGGGATTTGCGATTCCCGGCAAGGAGGGCAAGGTGCTCCGCCTGCG CAAGGCCCTCTATGGCTTGCGGCAGGCACCAAGGGCGTGGAATGCCAAGC TGGATTCCACGCTGAAGGGGATGGGCTTCGAGCAAAGCCCACACGAGGCG GCCATCTACCGGCGGGGCAGCGGAGGAAAGGCCCTGCTGGTAGGCGTCTA CGTCGACGACTTGGTGATCACCGGCACCAAGGATGCGGAGGTGGCGGCAT TCAAGGAAGAGATGAAGGCCACCTTCCAGATGAGTGATCTGGGGTCTCTC TCCTTCTACCTGGGGATCGAGGTGCACCAGGATGACTCCGGGATCACGCT TCGACAGACCGCCTACGCCAAGCGCATCGTTGAGCTAGCGGGGCTCACCG ACTGCAACCCAGCCCTCACTCCGATGGAGGAGAGGCTGAAGCTGAGCCGC GACAGCACGACGGAGGAGGTGGACGCTACGCAGTACCGGCGTCTTGTGGG GAGCCTTCGCTACCTCGCCCACACACGGTCGGACTTGGCATTCTCCGTCG GCTACGTTAGTCGGTTCATGCAGCGACCGACGACGGAGCACCAGCAGGCT GTGAAGAGGATCATCCGCTACGTTGCGGGGACTCTCGACCACGGCCTCTA CTACCCGAGGTGCCCTGGGGCGGCACACTTCGTCGGGTACAGCGACAGCG ACCACGCCGGCGACATCGACACCAGCAAGAGCACGAGCGGGATCCTCTTC TTCCTCGGCAAGTGCCTCGTTAGCTGGCAGTCGGTCAAGCAGCAGGTGGT GGCCCTGTCTAGCTGCGAGGCCGAGTACATAGCGGCCTCCACCGCTTCGA CTCAGGCGCTCTGGCTCGCTCGACTGCTTGGTGATCTCCTTGGCAGAGAC ACTAGAGCGGTGGAGCTCAGGGTGGACAGCAAGTCCGCCCTGGCCCTAGC AAAGAACCCCGTGTTCCACGAACGCAGCAAGCACATCCGGGTGAGGTACC ACTTCATCCGAGGCTGTTTGGAGGAAGGAAGCATCAAGGCGAGCTACATC AACACCAAGGACCAGCTTGCGGACCTGCTCACCAAGCCCCTTGGGAGGAT CAAGTTCCTTGAGCTCTGCTCCAGGACCGGGATGGTTCAACTCTCCCACA AAACGACGCACAAGACTTAGGGGGAGAATGATGGATAAGTCTCATGTGTG GTTGGTCTTTGTGGGGCTGTGCTGCTCACATGGTCCTTGTGGCTGTTTTT CTGTTTTTAGGACAGCATCTTAGACTAGAGGACAGCATCTTAGAGGACAA CATCTTAGACTAGAGGACAGCATCTTAGAGGACAGCATCTTAGACTAGAG GACAGCATCTTAGCTAGGACAGCACTTTAGCATCTTAGACTAGCATCTTA GACTAGCATATTGGCATATGCTTGGCTGGCTAGCAGCCTATAAATATGTA ACCCCAACCCCTCAGGTTGGCATGGCATTGTATGAGTTTGTGTGAGAAAT AAACCAGAAAATTGTCCCAACTCCTAGTGTCATCCTCTCTCGATGAGAGT AAGGATTCAGCTACTACCAAGAGTGCGAATCCAGCGACTAACAGGGTGAA CCACTCAGTAAGTTGAGGGACATGAAATTGCAAATTAATAGTTCGGGGAC CTACATAACACACTTGTACAAGTTTTAGGGACTGCTGATGCATTTTACTC CTATTAAGACTAGAGCAAGACTCTTCTAGACATCTACTGGAAAAAATTCC AGCATCCTAGTATGCAGGGGTTGCAAAGAGTAGTTTCTTTTTAGTTTGAA CTTTTAATATATTGAAATAGCAGATTGTATGTCGGGAGTTTGTACAAGTC TTGTTCTAATCCTGAACTGATGTTATTGTTGGGCTGATTGTGAAGTATTT TCTACCAGAAAGTTAACATCACTTGCAATTGTCGTAATCTAAATGAAAAC ATTTGAATCGAACTATTTAATGTTCAAAGCATGTTGCAACAAAACATGGA TATTATTGGGTTTTTTTTGTGGGGAATGAGTTTGTATTGGAAAATGACCT GAAACAATGAGTTTTCTGGATTGATTGGCATATATAGATAAGTTGATCAT CAGTAGTGGTGAGGATGGTACTGCAGAGAAGAAACAAGGATCCCAGAGAC AACATTTGTGATTAGGATAGTGATGGCATAATAATTACTAGTGCAGACAC AAGTTTACAAGGATAATAACCATGAAAAACTCAATCCAAGCTCTATGGGC TAAAAAAAAAGATAAAATGACGCACAACTTTTCTGTATATTATAAGTTAG CTCATGCACATTGTTTTGTGTGCAGGCACTCTTCTATTCAGCCCTCTTGT GTGCGCGTGAGATGTTGACTCCAGAAGACGGATCAGCTGACTTAATCCGT GCCCTGAACAATAGACTTATTGCATTGTCCTTTCATATCAGGGAGTACTA CTGGCTTGACATGCAAAAATTGAATGAGATATATCGATATAAAACAGAAG AATATTCTTATGATGCTGTCAACAAGTTCAACATATACCCCGATCAGATT TCTCCATGGCTTGTTGAGTGGATACCTCCTAAGGGGGGTTACTTTATTGG AAACCTCCAGCCAGCTCATATGGACTTCCGATTCTTTTCACTGGGAAATT TATGGTCAATAGTAAGCAGCTTGGCAACAACTCAGCAGTCGCATGCCATT TTAGATCTTATTGAGTCTAAATGGTCTGATTTAGTGGCAGAGATGCCACT AAAGATATGCTATCCTGCTCTTGAGAACCAGGAATGGAAAATCATCACTG GGAGTGACCCTAAAAACACGTGAGCCTTAGATAATTCTCAATTTTTACCC TCTACCTGGGATCATGTTGCAGTTCCTTCTCACATACTTGGCGATTTCTT TTGATACAGGCCTTGGTCGTACCACAATGGAGGATCCTGGCCAACATTAC TGTGGCAGGTTTGCATTCTCTAAACTGTTTTCCTATTACTGTAGATTTAC TGTCTCTTGATGTTGAATTGGTTTTTATTTGTCCATATGTTGTCATTTTG ATACACTGTTGCATTTAGCCAAACTTGCTGAGATTTACTGGCAATCTGTC TGCTCACATTTTGTTGCTCCTCTATCATGTGCATATTGAATGTTGTTGAG CAGTTGCTATCATTTTGTGCAGCTCACTGTGGCATGCATCAAGATGAACA GACCAGAGCTTGCAGCCAAAGCTATAGAGGTAGCTGAGAGGCGTATTGCT ACAGACAAATGGCCTGAATACTACGACACCAAGAAAGCACGCTTCATTGG GAAACAGGCACGGCTGTACCAAACGTGGTCTATTGCTGGGTTCCTAGTAG CCAAGCTACTGATAGAAAAACCAGACGCTGCTAGGATTCTGTGGAACGAC GAGGATGCAGAAATCCTTAATGCTTTGAGCACAAACAGAAAACGGGGCAA GAAAGTGTTGAAGAGAACATACATTGTGTGAGTTCTCGCAGCAAGTTCCA TCAAATAACCTAAGTTAGCATTTTTAAGTTATAGGAAGTGTCGTTCCTGT ATATAAACTTTACATGAGGTTGCATTTTTGATGGGGAGGGTGCCTTCTGT TGGATGCTGTTATTATGGATGCATCTGGCTTTGCAACAAAGCTCTTGGTG TAGTTTGCTATACACTTCATTTGGCATGACAAGTTTTCTGCAGTCTCATT ACCGAACTTTAAATTTTTGGTTCCTG
back to top

Coding sequence (CDS) from alignment at Sh_009H11:30883..42058+

>Sh_009H11_t000040 ID=Sh_009H11_t000040|Name=Sh_009H11_t000040|organism=R570 Sugarcane cultivar|type=CDS|length=1812bp|location=Sequence derived from alignment at Sh_009H11:30883..42058+ (R570 Sugarcane cultivar)
ATGGGGATCGCGGAGGTGGCTCTCCACACCATGCCGGGGGCGTTCACCAC
CCACTCCCCGGCATCCATTCTGTCCCTTGGGGCAGTCGCTAGGAGGAGGA
ACAGGAACACCAATTCGGTGCCCAACGCCAGGGCACTGCAAGGCCTCCTA
AGGATCCCGAGGCTGAGGTCCGTCAGGCGGCTGTGCCAGCGGATCGATGA
CCTTGCGAGGGTCACAGAGGGGAACGGGACTTGGGTAAAGGATGCCATGA
ATAAGGCCGGCCAGGTTCTTGGCGACATCAGCGTGCCTGGTCAGGTTGTA
GGTGGCAATGGTGGTCTAAATGGGAGTGCTGCCAAGCCTCCACCTCAGAG
GCGGAAGTCCTCATCGGTTGAGGATGAGGCCTGGGAACTTCTGCAGGAGT
CAATGGTTTACTATTGTGGTAGTCCTGTTGGGACGATTGCTGCAAACGAT
CCAAATGACAGTGATCCGGTGAACTACGATCAGGTATTTATTCGGGACTT
CATACCATCCGGCATTGCTTTTCTACTGAAGGGGGAATATGAAATTGTGC
GCAATTTCATTCTACACACCCTTCAGCTTCAGAGCTGGGAGAAGACAATG
GACTGCCATAGTCCAGGTCAAGGTTTAATGCCTGCCAGCTTCAAAGTGCG
GACAATTCCGCTTGATGGTGATGAGGATGCAACTGAGGAGGTCTTGGATC
CTGATTTTGGGGAGGCCGCAATAGGCCGCGTGGCACCTGTTGATTCAGGT
CTATGGTGGATCATATTGCTTAGGGCATATGGAAAATGTTCAGGGGATAT
GTCAGTACAGGAGAGAATTGATGTCCAGACTGGAATGAAAATGATTCTGA
AGCTTTGTTTAGCTGATGGTTTCGACATGTTCCCTACATTACTTGTAACT
GATGGTTCATGCATGATTGATCGTCGAATGGGAATCCATGGGCATCCACT
TGAAATTCAGGCACTCTTCTATTCAGCCCTCTTGTGTGCGCGTGAGATGT
TGACTCCAGAAGACGGATCAGCTGACTTAATCCGTGCCCTGAACAATAGA
CTTATTGCATTGTCCTTTCATATCAGGGAGTACTACTGGCTTGACATGCA
AAAATTGAATGAGATATATCGATATAAAACAGAAGAATATTCTTATGATG
CTGTCAACAAGTTCAACATATACCCCGATCAGATTTCTCCATGGCTTGTT
GAGTGGATACCTCCTAAGGGGGGTTACTTTATTGGAAACCTCCAGCCAGC
TCATATGGACTTCCGATTCTTTTCACTGGGAAATTTATGGTCAATAGTAA
GCAGCTTGGCAACAACTCAGCAGTCGCATGCCATTTTAGATCTTATTGAG
TCTAAATGGTCTGATTTAGTGGCAGAGATGCCACTAAAGATATGCTATCC
TGCTCTTGAGAACCAGGAATGGAAAATCATCACTGGGAGTGACCCTAAAA
ACACGCCTTGGTCGTACCACAATGGAGGATCCTGGCCAACATTACTGTGG
CAGCTCACTGTGGCATGCATCAAGATGAACAGACCAGAGCTTGCAGCCAA
AGCTATAGAGGTAGCTGAGAGGCGTATTGCTACAGACAAATGGCCTGAAT
ACTACGACACCAAGAAAGCACGCTTCATTGGGAAACAGGCACGGCTGTAC
CAAACGTGGTCTATTGCTGGGTTCCTAGTAGCCAAGCTACTGATAGAAAA
ACCAGACGCTGCTAGGATTCTGTGGAACGACGAGGATGCAGAAATCCTTA
ATGCTTTGAGCACAAACAGAAAACGGGGCAAGAAAGTGTTGAAGAGAACA
TACATTGTGTGA
back to top