Sh_009H11_t000050

Overview
NameSh_009H11_t000050
Unique NameSh_009H11_t000050
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length786
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_009H11contigSh_009H11:46749..47976
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteSNAP25 homologous protein SNAP33
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_009H11_g000050Sh_009H11_g000050R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_009H11_p000050Sh_009H11_p000050R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_009H11_t000050 ID=Sh_009H11_t000050|Name=Sh_009H11_t000050|organism=R570 Sugarcane cultivar|type=mRNA|length=786bp
ATGCCACGCGGCGGCAAGCCCGCGGCTTCGTCGAAGCCAAACCCCGTCGA
CTCCGACTCGGACTCCGAGTCTAACAATAAGCCGGCGGCGAAGAAGTCCG
GGGCGTACCAGGCCCCCGCCGACGCCAAGAAGCGGTACAAGGACGGGTTC
CGCGACTCGGGCGGGCTGGAGAACCAGTCGGTGCAGGAGCTGGAGCACTA
CGCCGCGTACAAGGCCGAGGAGACCACCGACGCGCTCGCCGGCTGCCTGC
GCATCGCCGAGGACATCAAGCAGGACGCGTCCGACACGCTCATCACGCTG
CACAAGCAGGGGGAGCAGATCAGCCGGACGCACGAGAAGGCCGTCGAGAT
CGACCAGGACCTCACCAAGAGCGAGTCGCTTCTCGGCAGCCTTGGAGGGT
TCTTCTCCAAGCCATGGAAGCCCAAGAAAACGAAGCAGATCAAGGGACCG
GCACAGGTGTCACGAGATGACTCCTTCAAGAAGAAGGCCAGCCGCATGGA
GCAGAGGGACAAGCTCGGGCTGAGCCCGCGAGGGAAGCGCGATCCTCGCC
ACTACGCCGAGGCCACCGATGCCATGGACAAAGTCCAGATCGAGAAGAAG
AAGCAGGACGACGCCCTCGATGACCTCAGCGGCGTGCTGGGCCAGCTCAA
GGGCATGGCCGTTGACATGGGCTCCGAGCTTGACAGGCAAAACGAAGCGC
TGGATAATCTGCAAGGCGACGTGGACGAGCTCAACTCCAGGGTGAAGGGA
GCCAACCAACGTGCGCGCAAGCTGGTTGCCGAGTAG
back to top

protein sequence of Sh_009H11_p000050

>Sh_009H11_p000050 ID=Sh_009H11_p000050|Name=Sh_009H11_p000050|organism=R570 Sugarcane cultivar|type=polypeptide|length=262bp
MPRGGKPAASSKPNPVDSDSDSESNNKPAAKKSGAYQAPADAKKRYKDGF
RDSGGLENQSVQELEHYAAYKAEETTDALAGCLRIAEDIKQDASDTLITL
HKQGEQISRTHEKAVEIDQDLTKSESLLGSLGGFFSKPWKPKKTKQIKGP
AQVSRDDSFKKKASRMEQRDKLGLSPRGKRDPRHYAEATDAMDKVQIEKK
KQDDALDDLSGVLGQLKGMAVDMGSELDRQNEALDNLQGDVDELNSRVKG
ANQRARKLVAE*
back to top

mRNA from alignment at Sh_009H11:46749..47976+

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_009H11_t000050 ID=Sh_009H11_t000050|Name=Sh_009H11_t000050|organism=R570 Sugarcane cultivar|type=mRNA|length=1228bp|location=Sequence derived from alignment at Sh_009H11:46749..47976+ (R570 Sugarcane cultivar)
ATGCCACGCGGCGGCAAGCCCGCGGCTTCGTCGAAGCCAAACCCCGTCGA CTCCGACTCGGACTCCGAGTCTAACAATAAGCCGGCGGCGAAGAAGTCCG GGGCGTACCAGGCCCCCGCCGACGCCAAGAAGCGGTACAAGGACGGGTTC CGCGACTCGGGCGGGCTGGAGAACCAGTCGGTGCAGGAGCTGGAGCACTA CGCCGCGTACAAGGCCGAGGAGACCACCGACGCGCTCGCCGGCTGCCTGC GCATCGCCGAGGACATCAAGCAGGACGCGTCCGACACGCTCATCACGCTG CACAAGCAGGGGGAGCAGATCAGCCGGACGCACGAGAAGGCCGTCGAGAT CGACCAGGACCTCACCAAGAGCGAGTCGCTTCTCGGCAGCCTTGGAGGGT TCTTCTCCAAGCCATGGAAGCCCAAGAAAACGAAGCAGATCAAGGGACCG GCACAGGTGTCACGAGGTACCCTACCTACGAGTACGACGACGATCGTGTC CTATCTAACATACACTGAAACTGAAACAAACTGAATAATGAAATGAAACA GATGACTCCTTCAAGAAGAAGGCCAGCCGCATGGAGCAGAGGGACAAGCT CGGGCTGAGCCCGCGAGGGAAGCGCGATCCTCGCCACTACGCCGAGGCCA CCGATGCCATGGACAAAGTCCAGGTTCCTCGTGACTGCTCTCTGCTCACT AATTAATACCGAGATTATCACTCAAATCAGCCAGTCAGCCAACCAGCAAT GTTTTTCTAAAAAAAACAGCCAGCAGTACTTTCAGCCAGCCAGATCAGCC CAAACGAACAGGCTGCAAGACGAAATCGAATAATTGCGACCCGGCAGCTA GCTATTAAGCCCTGTTAATTTGTGAATCTTGCAGATCGAGAAGAAGAAGC AGGACGACGCCCTCGATGACCTCAGCGGCGTGCTGGGCCAGCTCAAGGGC ATGGCCGTTGACATGGGCTCCGAGCTTGACAGGTGAGCTTGTGGCCTCCT CCTTGATGGAGTTGCCGAACCAGATCGAGTAGCTCAACATTCTCGATCAG CAATCTTTGGATCTTGGGTTTGGATGGCAATGCTACTGCTAGTACTGTCG AAGTAATTTGTTCTGCTCAACATTTCAGGCAAAACGAAGCGCTGGATAAT CTGCAAGGCGACGTGGACGAGCTCAACTCCAGGGTGAAGGGAGCCAACCA ACGTGCGCGCAAGCTGGTTGCCGAGTAG
back to top

Coding sequence (CDS) from alignment at Sh_009H11:46749..47976+

>Sh_009H11_t000050 ID=Sh_009H11_t000050|Name=Sh_009H11_t000050|organism=R570 Sugarcane cultivar|type=CDS|length=786bp|location=Sequence derived from alignment at Sh_009H11:46749..47976+ (R570 Sugarcane cultivar)
ATGCCACGCGGCGGCAAGCCCGCGGCTTCGTCGAAGCCAAACCCCGTCGA
CTCCGACTCGGACTCCGAGTCTAACAATAAGCCGGCGGCGAAGAAGTCCG
GGGCGTACCAGGCCCCCGCCGACGCCAAGAAGCGGTACAAGGACGGGTTC
CGCGACTCGGGCGGGCTGGAGAACCAGTCGGTGCAGGAGCTGGAGCACTA
CGCCGCGTACAAGGCCGAGGAGACCACCGACGCGCTCGCCGGCTGCCTGC
GCATCGCCGAGGACATCAAGCAGGACGCGTCCGACACGCTCATCACGCTG
CACAAGCAGGGGGAGCAGATCAGCCGGACGCACGAGAAGGCCGTCGAGAT
CGACCAGGACCTCACCAAGAGCGAGTCGCTTCTCGGCAGCCTTGGAGGGT
TCTTCTCCAAGCCATGGAAGCCCAAGAAAACGAAGCAGATCAAGGGACCG
GCACAGGTGTCACGAGATGACTCCTTCAAGAAGAAGGCCAGCCGCATGGA
GCAGAGGGACAAGCTCGGGCTGAGCCCGCGAGGGAAGCGCGATCCTCGCC
ACTACGCCGAGGCCACCGATGCCATGGACAAAGTCCAGATCGAGAAGAAG
AAGCAGGACGACGCCCTCGATGACCTCAGCGGCGTGCTGGGCCAGCTCAA
GGGCATGGCCGTTGACATGGGCTCCGAGCTTGACAGGCAAAACGAAGCGC
TGGATAATCTGCAAGGCGACGTGGACGAGCTCAACTCCAGGGTGAAGGGA
GCCAACCAACGTGCGCGCAAGCTGGTTGCCGAGTAG
back to top