Sh_009H11_t000090

Overview
NameSh_009H11_t000090
Unique NameSh_009H11_t000090
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length201
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_009H11contigSh_009H11:79104..79304
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteConserved hypothetical protein
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_009H11_g000090Sh_009H11_g000090R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_009H11_p000090Sh_009H11_p000090R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_009H11_t000090 ID=Sh_009H11_t000090|Name=Sh_009H11_t000090|organism=R570 Sugarcane cultivar|type=mRNA|length=201bp
ATGGCGTCAGGGTCGTACTACCGGCGAGCGCCGTGCAACGACGACCCGAT
CGGCCGGCGGCCGACACCGAGCGGCAGCGACGACGGCCATGCGGAAATCA
GCGGGTCCAGGACCCCGAGGGTGGGACCGCCGTCTCCAACGTGGGGAACC
GCCCGGGCGGCCGGGACCTCCGGCCCCACACCCCCGGGGATCATCAACTA
G
back to top

protein sequence of Sh_009H11_p000090

>Sh_009H11_p000090 ID=Sh_009H11_p000090|Name=Sh_009H11_p000090|organism=R570 Sugarcane cultivar|type=polypeptide|length=67bp
MASGSYYRRAPCNDDPIGRRPTPSGSDDGHAEISGSRTPRVGPPSPTWGT
ARAAGTSGPTPPGIIN*
back to top

mRNA from alignment at Sh_009H11:79104..79304-

Legend: polypeptideexonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_009H11_t000090 ID=Sh_009H11_t000090|Name=Sh_009H11_t000090|organism=R570 Sugarcane cultivar|type=mRNA|length=201bp|location=Sequence derived from alignment at Sh_009H11:79104..79304- (R570 Sugarcane cultivar)
ATGGCGTCAGGGTCGTACTACCGGCGAGCGCCGTGCAACGACGACCCGAT CGGCCGGCGGCCGACACCGAGCGGCAGCGACGACGGCCATGCGGAAATCA GCGGGTCCAGGACCCCGAGGGTGGGACCGCCGTCTCCAACGTGGGGAACC GCCCGGGCGGCCGGGACCTCCGGCCCCACACCCCCGGGGATCATCAACTA G
back to top

Coding sequence (CDS) from alignment at Sh_009H11:79104..79304-

>Sh_009H11_t000090 ID=Sh_009H11_t000090|Name=Sh_009H11_t000090|organism=R570 Sugarcane cultivar|type=CDS|length=201bp|location=Sequence derived from alignment at Sh_009H11:79104..79304- (R570 Sugarcane cultivar)
ATGGCGTCAGGGTCGTACTACCGGCGAGCGCCGTGCAACGACGACCCGAT
CGGCCGGCGGCCGACACCGAGCGGCAGCGACGACGGCCATGCGGAAATCA
GCGGGTCCAGGACCCCGAGGGTGGGACCGCCGTCTCCAACGTGGGGAACC
GCCCGGGCGGCCGGGACCTCCGGCCCCACACCCCCGGGGATCATCAACTA
G
back to top