Sh_009H11_t000110

Overview
NameSh_009H11_t000110
Unique NameSh_009H11_t000110
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length217
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_009H11contigSh_009H11:85840..87535
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_009H11_g000110Sh_009H11_g000110R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_009H11_p000110Sh_009H11_p000110R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_009H11_t000110 ID=Sh_009H11_t000110|Name=Sh_009H11_t000110|organism=R570 Sugarcane cultivar|type=mRNA|length=217bp
TTTTCTGGGTACACAATGGTCGGAGGCTCTCAGCGAGGGACGTTTTACTG
GGTGGACCAAATTCTACATGGTAAAGCCCTGTCCGAAGGAGATGAAATGC
GATGTTGAGTTGAGTTCATATGCAATTAGGGATGCTGAAGAGTACAAGAA
TTTCTGTGACCGTCAAAAGGATCAGAGGCCACAGCCAGAAGAAGTAATTG
CGCCTCTGGTGTTTTGA
back to top

protein sequence of Sh_009H11_p000110

>Sh_009H11_p000110 ID=Sh_009H11_p000110|Name=Sh_009H11_p000110|organism=R570 Sugarcane cultivar|type=polypeptide|length=72bp
FLGTQWSEALSEGRFTGWTKFYMVKPCPKEMKCDVELSSYAIRDAEEYKN
FCDRQKDQRPQPEEVIAPLVF*
back to top

mRNA from alignment at Sh_009H11:85840..87535-

Legend: polypeptideexonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_009H11_t000110 ID=Sh_009H11_t000110|Name=Sh_009H11_t000110|organism=R570 Sugarcane cultivar|type=mRNA|length=1696bp|location=Sequence derived from alignment at Sh_009H11:85840..87535- (R570 Sugarcane cultivar)
AAGCTTGCATCAAACATGAAATCGTGACCATAGGATTTAGTCTTAGTGTT TTATTAGCCCTTGATTTTAACGGAGACGAATTCCTGTGTGCAGTTTTCTG GGTACACAATGGTCGGAGGCTCTCAGCGAGGGACGTTTTACTGGGTGGAC CAAGTATAATTTAAGTGTTCCATTATAGTAGAGATTAAACATTTCTTTGC CATTTTGCATTATATATTCTTGCGATGTGTAGTGCTTTTGTTTGGCCACT GTAAGGATCTGATGATGCCATTAGTTTGGAGTATTGAGAATATGGTTCCA TTATTCTGCAAGAAAGGCTTCATATGCCTGTTGATAGGATAGTATTCAGA TTAAATTTGGATTTCTGTTCTTCTGTGTCCATTCTATTTCCAATATCTTA TGTGTTCTACGTATGTGCAAATAATGATACGTTCTGGTCCCTCCAGAGAT TCTACATGGTAAAGCCCTGTCCGAAGGAGATGAAATGCGATGTTGAGGTG AGCTCAAATTTAACATAGTTCCTCTGAGATCTGCAATGTCGTGAAGTTGA TGTACTGAACAAACTAATGCATCTTTACTAATATTTATCAGAATTTACTA GTAGTATTCAGTTCATTCTCCTCTACTTTTGTCAAAAAAAAAAAGACTAT TTGAGCAAATGGTATATCCTATTCCTATTTAGCTATAAACTAGGAAAATA TGCATCTGGTTCCAAAACATGATGTTATTTAAGGCCATTCCCACAGTTGC AGTTCTCATGTTCAATACACAAGTGGTTAGGTATACTTAATGATTACTCA AAAAAGCTTGGTGTGATGCAACTTGTCCATAGTGGGGAGCATAAAATGGT CTATTTAGAGCACATAGTATTTTCTAAAGTGCTGCTTTTATTTGATTGTT CTGACAATTATTTTTTTGTTGTGGCATTAATAACATTTGAGTGAGTCTAT TAATATCTAGAATCATTACCTTTTGTTTTCTGGTGTCTACAATGGCTGTG GCATAAAATTTTGGTTGAAGTAATGCAACTTCTCATCCATGTTCCTGCTT TTAGGGCTTTTAGGAAAACTGAAAGATATTAATATTTTAGAACAACTTTG CAGGCAAAGCTGACTAAATAACATTTTACTTTCTTTTTCAATTGACAGTT GAGTTCATATGCAATTAGGGATGCTGAAGAGTACAAGAATTTCTGTGACC GTCAAAAGGATCAGAGGCCACAGCCAGAAGAAGTAATTGCGGTATGTCAT GTCCGAACACAATCTTACTTTTCAGAATGTTTGCTTGTGAAGTTTCCCCC TTCATTTACTCGTGACTGTTGGTGACTAAACTCTTGAGGGACAGCTACAA ATGAAATGATGGAAATATTTTACAACAATTAGGTAAATCTAATCAGCTTA ATGATTATTCTTAGTCACCCTGTGCATATTAATGTGTGTAAAGGGAATTA GGGACCAGGTGGAGTTGCCAATGAATGAATGAATGAATCCACAGGAAATA GAAATGCTGTTGTTTGTATTATCAAGGGAGGTATCCCATCTGTCACAAGA CCAAAGATGTAGGGTAGTTCAATGGGTTTTCAATATGATTGATTGATTGA TAAGCCATGGATCACCACTTTTGCTTTTAATATTCATTTGCAGCCTCTGG TGTTTTGAATATGGACTTCAATGCTGTTGTGCTACTCCTGACCTAA
back to top

Coding sequence (CDS) from alignment at Sh_009H11:85840..87535-

>Sh_009H11_t000110 ID=Sh_009H11_t000110|Name=Sh_009H11_t000110|organism=R570 Sugarcane cultivar|type=CDS|length=217bp|location=Sequence derived from alignment at Sh_009H11:85840..87535- (R570 Sugarcane cultivar)
TTTTCTGGGTACACAATGGTCGGAGGCTCTCAGCGAGGGACGTTTTACTG
GGTGGACCAAATTCTACATGGTAAAGCCCTGTCCGAAGGAGATGAAATGC
GATGTTGAGTTGAGTTCATATGCAATTAGGGATGCTGAAGAGTACAAGAA
TTTCTGTGACCGTCAAAAGGATCAGAGGCCACAGCCAGAAGAAGTAATTG
CGCCTCTGGTGTTTTGA
back to top