Sh_009I06_t000020

Overview
NameSh_009I06_t000020
Unique NameSh_009I06_t000020
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length600
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_009I06contigSh_009I06:3304..3903
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteAP2-EREBP transcription factor
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_009I06_g000020Sh_009I06_g000020R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_009I06_p000020Sh_009I06_p000020R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_009I06_t000020 ID=Sh_009I06_t000020|Name=Sh_009I06_t000020|organism=R570 Sugarcane cultivar|type=mRNA|length=600bp
ATGCTGCTGAACCCGACGTCGGAGGCGTTGGTGCTGGACACCATCCGGCA
GCATTTCCTGGAGGAGCCAGCGGCGGCGCGGCCGGCTGACGAGAGCTTCG
GGAGCCTGGTGGCGGACCGGTGGAGCGGCTCGCTCCCGTTCCGCACCGAT
GACGCCGATGACATGGTGGTGTTCGGGGCGCTGCAGGACGCCTTCGCCTA
CGGCTGGCTGCCCGACGGCTCCTTCGCGCACGTGAAGCCCGAGCCGGCGA
GGTCCCCCGACGACTCGGCCTACTCCTACTCCTACGATGGCTCCTCCTGC
TTTGGCGGCTTCCTGGACCTGGCGGAGCCGCTGACGCCCAGCAGCGAGGG
CGGCGAGGCGGCCGCCACGCCCAGGCGAGAGGAGGCCGCGGCAGCCGTGG
CCAGGGGCAAGCACTACAGAGGCGTCAGGCAGCGCCCGTGGGGCAAGTTG
CGGCGGAGATCAGGGGTGGAAGGAGGTCGGCCATGGAAGCGGCCCTGGAG
TCCTTGGCGAGCTGCCCGGCGGCGGGTAGTCCCAGGCCTACCTGGACTAC
CCGCTGCGTCCGCCACTGCGTGCTTCCAAGTTCGCCTGCTGTCACGCTGA
back to top

protein sequence of Sh_009I06_p000020

>Sh_009I06_p000020 ID=Sh_009I06_p000020|Name=Sh_009I06_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=200bp
MLLNPTSEALVLDTIRQHFLEEPAAARPADESFGSLVADRWSGSLPFRTD
DADDMVVFGALQDAFAYGWLPDGSFAHVKPEPARSPDDSAYSYSYDGSSC
FGGFLDLAEPLTPSSEGGEAAATPRREEAAAAVARGKHYRGVRQRPWGKL
RRRSGVEGGRPWKRPWSPWRAARRRVVPGLPGLPAASATACFQVRLLSR*
back to top

mRNA from alignment at Sh_009I06:3304..3903+

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_009I06_t000020 ID=Sh_009I06_t000020|Name=Sh_009I06_t000020|organism=R570 Sugarcane cultivar|type=mRNA|length=600bp|location=Sequence derived from alignment at Sh_009I06:3304..3903+ (R570 Sugarcane cultivar)
ATGCTGCTGAACCCGACGTCGGAGGCGTTGGTGCTGGACACCATCCGGCA GCATTTCCTGGAGGAGCCAGCGGCGGCGCGGCCGGCTGACGAGAGCTTCG GGAGCCTGGTGGCGGACCGGTGGAGCGGCTCGCTCCCGTTCCGCACCGAT GACGCCGATGACATGGTGGTGTTCGGGGCGCTGCAGGACGCCTTCGCCTA CGGCTGGCTGCCCGACGGCTCCTTCGCGCACGTGAAGCCCGAGCCGGCGA GGTCCCCCGACGACTCGGCCTACTCCTACTCCTACGATGGCTCCTCCTGC TTTGGCGGCTTCCTGGACCTGGCGGAGCCGCTGACGCCCAGCAGCGAGGG CGGCGAGGCGGCCGCCACGCCCAGGCGAGAGGAGGCCGCGGCAGCCGTGG CCAGGGGCAAGCACTACAGAGGCGTCAGGCAGCGCCCGTGGGGCAAGTTG CGGCGGAGATCAGGGGTGGAAGGAGGTCGGCCATGGAAGCGGCCCTGGAG TCCTTGGCGAGCTGCCCGGCGGCGGGTAGTCCCAGGCCTACCTGGACTAC CCGCTGCGTCCGCCACTGCGTGCTTCCAAGTTCGCCTGCTGTCACGCTGA
back to top

Coding sequence (CDS) from alignment at Sh_009I06:3304..3903+

>Sh_009I06_t000020 ID=Sh_009I06_t000020|Name=Sh_009I06_t000020|organism=R570 Sugarcane cultivar|type=CDS|length=600bp|location=Sequence derived from alignment at Sh_009I06:3304..3903+ (R570 Sugarcane cultivar)
ATGCTGCTGAACCCGACGTCGGAGGCGTTGGTGCTGGACACCATCCGGCA
GCATTTCCTGGAGGAGCCAGCGGCGGCGCGGCCGGCTGACGAGAGCTTCG
GGAGCCTGGTGGCGGACCGGTGGAGCGGCTCGCTCCCGTTCCGCACCGAT
GACGCCGATGACATGGTGGTGTTCGGGGCGCTGCAGGACGCCTTCGCCTA
CGGCTGGCTGCCCGACGGCTCCTTCGCGCACGTGAAGCCCGAGCCGGCGA
GGTCCCCCGACGACTCGGCCTACTCCTACTCCTACGATGGCTCCTCCTGC
TTTGGCGGCTTCCTGGACCTGGCGGAGCCGCTGACGCCCAGCAGCGAGGG
CGGCGAGGCGGCCGCCACGCCCAGGCGAGAGGAGGCCGCGGCAGCCGTGG
CCAGGGGCAAGCACTACAGAGGCGTCAGGCAGCGCCCGTGGGGCAAGTTG
CGGCGGAGATCAGGGGTGGAAGGAGGTCGGCCATGGAAGCGGCCCTGGAG
TCCTTGGCGAGCTGCCCGGCGGCGGGTAGTCCCAGGCCTACCTGGACTAC
CCGCTGCGTCCGCCACTGCGTGCTTCCAAGTTCGCCTGCTGTCACGCTGA
back to top