Sh_009I06_t000030

Overview
NameSh_009I06_t000030
Unique NameSh_009I06_t000030
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length573
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_009I06contigSh_009I06:48380..51214
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
Notesimilar to Expressed protein
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_009I06_g000030Sh_009I06_g000030R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_009I06_p000030Sh_009I06_p000030R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_009I06_t000030 ID=Sh_009I06_t000030|Name=Sh_009I06_t000030|organism=R570 Sugarcane cultivar|type=mRNA|length=573bp
ATGCAGGCTCTTGTGATTATACCGGAGCAGCGCAACCACCATCACCGCCA
CCCTGGTCCCCGTAGCAAGTCATCGGGTCCACACTTTTTATCACCGCCTA
CCTCTCGCGGCTTCTGTGGAACGAACTGCCGGTCATTCCACTCTGGTGGC
TGCGTTGGTGTTCTCCCTTCCCCACCACCTCCGCCTGCCCGCACCTACTC
ATCCCTGGAGCCCAAGACACCCAAGCAGCAGCCACGCCATGGTGGCAAGC
GAAGCCGGCCTGTTTCCATAAGCCCCTCCACATCTCCTCCCACCCATTCT
GAGCTGTGGGCGGGCCCAGCATTCTCCAACTCACCACCACCCAGTTCGCT
TCCCATCCCCAAATTCTCCCTCCGCCAGAAGCGCAGCATCTCTCTCGAGC
TGCCACCAGTTGAGCGCTCTGATGATGTGGAGGTCAGACTGCATGCTAAA
TCAGCACCTTCATCCCCGGTTGAGGGATCAGGGTATGACTTCTTCAATGA
TGATGCAATTGCAAGTGCTATAGCAACGGAGAATCTGAGGAGGATTCTCC
AGTTGGATATTGCTGATCATTGA
back to top

protein sequence of Sh_009I06_p000030

>Sh_009I06_p000030 ID=Sh_009I06_p000030|Name=Sh_009I06_p000030|organism=R570 Sugarcane cultivar|type=polypeptide|length=191bp
MQALVIIPEQRNHHHRHPGPRSKSSGPHFLSPPTSRGFCGTNCRSFHSGG
CVGVLPSPPPPPARTYSSLEPKTPKQQPRHGGKRSRPVSISPSTSPPTHS
ELWAGPAFSNSPPPSSLPIPKFSLRQKRSISLELPPVERSDDVEVRLHAK
SAPSSPVEGSGYDFFNDDAIASAIATENLRRILQLDIADH*
back to top

mRNA from alignment at Sh_009I06:48380..51214+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_009I06_t000030 ID=Sh_009I06_t000030|Name=Sh_009I06_t000030|organism=R570 Sugarcane cultivar|type=mRNA|length=2835bp|location=Sequence derived from alignment at Sh_009I06:48380..51214+ (R570 Sugarcane cultivar)
GCCGAACCCAAAAGCCCCCGCCCACCTCGACGCGGATTCTCTCGCCGGCG GTTGTTCCGGGATCCGGCTTTGGGCCCGTGGATCGGCGCGCTGCCGCCTC CTCCCGGGTTTTCGCGCTCCGGAAGTGGCGAGATTCGGCGAGAAAGGTTA GATCCAGCGGCCTGCTTCGAGCTACAGGTTCGTTGGACCTGAGGGGTGTG GTCGATGGCTGTCCCTTGCGAGATTCCTGATCGGAGGTTTCCGTGCGTGC CTGCAGTGTGTTCGCGGGTGGATCTGCATTGGAGCATCGGGGGATTCGCG TGACGGAGACGACGTCGTCCGTGGTGGCTCCGGTTTGCTCCTCGGCTCTA GATCTGGAAGGTATACACCCCCCTAACTTCCTTCTTCTTTCCTTCAGATG AAAGTCTTTTTTTCGGCCATCTTAGCTATTCGTTCCTTTCGTCCAAACAG CAACTTTACTCTCATACGTTGCTGCTGTATGCTTACTCTGAACTGCAGTG TGGTTTCAGTGGTTTCTCTCAATGGTGTAATGTCAGAAAAGGGTCGCTTT GCACTATTGATATTATATTAACAGTGTTCATTTGTGTTGTTTGGGATAGT TCATGCTAATGATTCTTGTGTATACAAAGGCACCTTTGATCTCCTTGTCT ATTCTGTTTGCTTTTCGTTACAACTGAATCACAGTAGGGTATCAGCAACA CTTCCTATGTGTGTAATTCTAGGGAGAGGCTAAGAGGGCGACAGTTACCA TCTGTTTCTATACGGGTTTATTCTGACATTTGTGGCATTAAGGGTGTTCT TTTTTCTTTGGTTAGATGTGGTTGTCTTATGCTGAAAGTGTGGTCAAAAG TGCAGCTTCTCATCACCTTGCTTACCTTGTCTGTCTTTCGTCAGGACTGT GGGACATCTGCCGCTGCAAACAGCCTGAGGTGTATTGGAAAGTGACCATC GTTCCCAGACATCGCCACCACAACGTAACCGGACATGCAGGCTCTTGTGA TTATACCGGAGCAGCGCAACCACCATCACCGCCACCCTGGTCCCCGTAGC AAGTCATCGGGTCCACACTTTTTATCACCGCCTACCTCTCGCGGCTTCTG TGGAACGAACTGCCGGTCATTCCACTCTGGTGGCTGCGTTGGTGTTCTCC CTTCCCCACCACCTCCGCCTGCCCGCACCTACTCATCCCTGGAGCCCAAG ACACCCAAGCAGCAGCCACGCCATGGTGGCAAGCGAAGCCGGCCTGTTTC CATAAGCCCCTCCACATCTCCTCCCACCCATTCTGAGCTGTGGGCGGGCC CAGCATTCTCCAACTCACCACCACCCAGTTCGCTTCCCATCCCCAAATTC TCCCTCCGCCAGAAGCGCAGCATCTCTCTCGAGCTGCCACCAGTTGAGCG CTCTGATGATGTGGAGGTCAGACTGCATGCTAAATCAGCACCTTCATCCC CGGTTGAGGGATCAGGGTATGACTTCTTCAATGATGATGCAATTGCAAGT GCTATAGCAACGGAGAATCTGAGGAGGATTCTCCAGTTGGATATTGCTGA TCATTGAATAATGGGAGGATGGAAGGGTGGTTCTTGTGTACATAGGTTAA TCTTTCACTGACAGCTTTCTACTTGCATTGGTAGTGTATAGGGTAATGAT GATAGATACTTGGTGGTTGTAAGATATATGGTCAGGATCATGGTGGAGGT GTAGCTTGTAGGTGAAGCTACTTCAGAAGCTTAGACAGTTTAAGTTGATG CTGCCCTGTTAGGTGTTATGAAGGTGGGCTCTGGGTTGAGGATGGGGTGC AGGGTAGTTGATAGTATTCACCTATATGCTTCCTTCATCTCTTAGGTGTA GGGTTTCAACCTCTTAAAACAGCATCATTTGCATCCATAGTACCTGTTCT GAACTGACGGTGGCACTCTGCCATAGCAGCAGCCTCATTTTCTGCTGCAG TTGGTTCATATATGGTAGAATAACATTCGTCCTAACCCCAACCAGATGTC AAATATCTGTAGGGTACCTGCATTTTGCATATCCTTGCATACTTATTTCC TTCTGTCCTCTAGCCAACTGGCTCTAGATATCCTTGCTTCCTGGTGCTCT GCAAAGAACACCATTGTCTCCTCACCAGCTCTTCTGGTTTTTGGTAAGGA AGAAGCTGAGTGGAAGATGGAAGAAATTCTGTTCTCTTCCTCTTGTTCCA ATACTGACTTCCCCATCCAGCCCCTTTGTTGCATATCTGGCATATACCAT ATATCTGTTGCATTTCCGTGCATTTATGTTCATCTAGTGCCCCTGCATTG CATCTAGTGCCCTTGTCAGTTAGCATGATCGTTCATTCTCACTTCAAGTT CACAAACCAGTTTGAGGGTTCTGATTTTCTTCAAGCGTCGAAAGATCCTG AGAGAGTCAGATTCTGGAGCCCTGCACGCATACAAACCCTGATGAGGTAA CTATTTGCTTATATTTTTGCAGCTGTTTGGGTGAATGCTGGTTTCAACAT TGGATACTGATGTTTGATTTATCTTGATGCAGGTTTGGTTGTGTAGCCCA ATGTTCTACCTGTTTTATAGTTACATAATGCCCAAGGTCCTGCTGGTGTT ATATGCTTTTGTAGACCTGTAGTTTTAGCACTAGCAGTGAAGCAGCAATA TCCGAACTTCCGGATCTAGACTATTAGTTGTCTGAAATGCTAAGTTTGGT TAGTTGTCTTTTACTGGTGTTATCAGCAGATGATATTATGTTGTGTCAGT TTAATGCGATAATGGTTCTATGCCATGAACTAGTTCATGATGTTAGAACC AGAAACTATGTTGCTTATACCCAAATATTTTTGTT
back to top

Coding sequence (CDS) from alignment at Sh_009I06:48380..51214+

>Sh_009I06_t000030 ID=Sh_009I06_t000030|Name=Sh_009I06_t000030|organism=R570 Sugarcane cultivar|type=CDS|length=573bp|location=Sequence derived from alignment at Sh_009I06:48380..51214+ (R570 Sugarcane cultivar)
ATGCAGGCTCTTGTGATTATACCGGAGCAGCGCAACCACCATCACCGCCA
CCCTGGTCCCCGTAGCAAGTCATCGGGTCCACACTTTTTATCACCGCCTA
CCTCTCGCGGCTTCTGTGGAACGAACTGCCGGTCATTCCACTCTGGTGGC
TGCGTTGGTGTTCTCCCTTCCCCACCACCTCCGCCTGCCCGCACCTACTC
ATCCCTGGAGCCCAAGACACCCAAGCAGCAGCCACGCCATGGTGGCAAGC
GAAGCCGGCCTGTTTCCATAAGCCCCTCCACATCTCCTCCCACCCATTCT
GAGCTGTGGGCGGGCCCAGCATTCTCCAACTCACCACCACCCAGTTCGCT
TCCCATCCCCAAATTCTCCCTCCGCCAGAAGCGCAGCATCTCTCTCGAGC
TGCCACCAGTTGAGCGCTCTGATGATGTGGAGGTCAGACTGCATGCTAAA
TCAGCACCTTCATCCCCGGTTGAGGGATCAGGGTATGACTTCTTCAATGA
TGATGCAATTGCAAGTGCTATAGCAACGGAGAATCTGAGGAGGATTCTCC
AGTTGGATATTGCTGATCATTGA
back to top