Sh_009I06_t000040

Overview
NameSh_009I06_t000040
Unique NameSh_009I06_t000040
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length477
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_009I06contigSh_009I06:55027..55503
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
Notesimilar to Expressed protein
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_009I06_g000040Sh_009I06_g000040R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_009I06_p000040Sh_009I06_p000040R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_009I06_t000040 ID=Sh_009I06_t000040|Name=Sh_009I06_t000040|organism=R570 Sugarcane cultivar|type=mRNA|length=477bp
ATGCGCTCCGATCCCTCGTTCCTCCTGTATATAAACCGAGCTAGCGTTCT
TCAGGTTGCCGTTGCGTTGTGCGTGCCAGGGAGAGAGAGACAGATAGACA
GCACCTCCTCCCCGTTACCCCGGCCGGTTGCTTTGCGAGATCTTGTTTGC
ATCCTGCCGATGGAGGTGGAGTCGGCCAAGTGCGAGTGCTGCGGCCTGCG
CGAGGACTGCACCGGGGAGTACATCGCCGCCGTCAAGGCGGGCTTCGGCG
GCCGCTGGCTCTGCGGCCTCTGCTCCGAGGCGGTGCGCGACGAGGTGGCC
GCCAAGAAGCGGGGGGACCTGGAGGGCGCACTCAGGGACCACATGTCCTT
CTGCGCCAAGTTCGGCAAGAAGGGCCCCGCGTTCCGCGTCGCCGACGGCA
TGCGCCAGATGCTGCGCAGGCGGTCCAGCGACATCTCCGCCGCCGCCGCC
GCCGCCGCCTCCTCCGCCGCCTCATGA
back to top

protein sequence of Sh_009I06_p000040

>Sh_009I06_p000040 ID=Sh_009I06_p000040|Name=Sh_009I06_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=159bp
MRSDPSFLLYINRASVLQVAVALCVPGRERQIDSTSSPLPRPVALRDLVC
ILPMEVESAKCECCGLREDCTGEYIAAVKAGFGGRWLCGLCSEAVRDEVA
AKKRGDLEGALRDHMSFCAKFGKKGPAFRVADGMRQMLRRRSSDISAAAA
AAASSAAS*
back to top

mRNA from alignment at Sh_009I06:55027..55503-

Legend: polypeptideexonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_009I06_t000040 ID=Sh_009I06_t000040|Name=Sh_009I06_t000040|organism=R570 Sugarcane cultivar|type=mRNA|length=477bp|location=Sequence derived from alignment at Sh_009I06:55027..55503- (R570 Sugarcane cultivar)
ATGCGCTCCGATCCCTCGTTCCTCCTGTATATAAACCGAGCTAGCGTTCT TCAGGTTGCCGTTGCGTTGTGCGTGCCAGGGAGAGAGAGACAGATAGACA GCACCTCCTCCCCGTTACCCCGGCCGGTTGCTTTGCGAGATCTTGTTTGC ATCCTGCCGATGGAGGTGGAGTCGGCCAAGTGCGAGTGCTGCGGCCTGCG CGAGGACTGCACCGGGGAGTACATCGCCGCCGTCAAGGCGGGCTTCGGCG GCCGCTGGCTCTGCGGCCTCTGCTCCGAGGCGGTGCGCGACGAGGTGGCC GCCAAGAAGCGGGGGGACCTGGAGGGCGCACTCAGGGACCACATGTCCTT CTGCGCCAAGTTCGGCAAGAAGGGCCCCGCGTTCCGCGTCGCCGACGGCA TGCGCCAGATGCTGCGCAGGCGGTCCAGCGACATCTCCGCCGCCGCCGCC GCCGCCGCCTCCTCCGCCGCCTCATGA
back to top

Coding sequence (CDS) from alignment at Sh_009I06:55027..55503-

>Sh_009I06_t000040 ID=Sh_009I06_t000040|Name=Sh_009I06_t000040|organism=R570 Sugarcane cultivar|type=CDS|length=477bp|location=Sequence derived from alignment at Sh_009I06:55027..55503- (R570 Sugarcane cultivar)
ATGCGCTCCGATCCCTCGTTCCTCCTGTATATAAACCGAGCTAGCGTTCT
TCAGGTTGCCGTTGCGTTGTGCGTGCCAGGGAGAGAGAGACAGATAGACA
GCACCTCCTCCCCGTTACCCCGGCCGGTTGCTTTGCGAGATCTTGTTTGC
ATCCTGCCGATGGAGGTGGAGTCGGCCAAGTGCGAGTGCTGCGGCCTGCG
CGAGGACTGCACCGGGGAGTACATCGCCGCCGTCAAGGCGGGCTTCGGCG
GCCGCTGGCTCTGCGGCCTCTGCTCCGAGGCGGTGCGCGACGAGGTGGCC
GCCAAGAAGCGGGGGGACCTGGAGGGCGCACTCAGGGACCACATGTCCTT
CTGCGCCAAGTTCGGCAAGAAGGGCCCCGCGTTCCGCGTCGCCGACGGCA
TGCGCCAGATGCTGCGCAGGCGGTCCAGCGACATCTCCGCCGCCGCCGCC
GCCGCCGCCTCCTCCGCCGCCTCATGA
back to top