Sh_009I06_t000050

Overview
NameSh_009I06_t000050
Unique NameSh_009I06_t000050
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length825
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_009I06contigSh_009I06:104663..106278
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
Notesimilar to Expressed protein, 3'-partial
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_009I06_g000050Sh_009I06_g000050R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_009I06_p000050Sh_009I06_p000050R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_009I06_t000050 ID=Sh_009I06_t000050|Name=Sh_009I06_t000050|organism=R570 Sugarcane cultivar|type=mRNA|length=825bp
ATGTTGGGGAGGATGCCTGGGCCAGGTGGCGGCGGAGTCTCGGAGCAGCG
CGAGGCCGCGTGTGATTTCGGCCGCCACACGGGCACCGCCGCAGTTCCGT
CGTTGCCGCCATCTCCCATCGTACCTCCGACGCTGTTCTTGGCTGCAGGG
AGCGGCGTCGTCGTCTCCGGAGAGGAGGCGTTGTTCTCGCCGCCGGCGGA
GCTAGCGGGGGCCGGCGTCGTGATGGTGAGCCCCACCTCCACGCTGCAGG
CACCGACCGGCGGCAGCCCCACGTCTGCGGCGAGCACGGCCGTTCCGTTC
TCCCGCCGCGGGGCGACGACCACCTCATCATCATCAGGCGGGGATTATGT
AGATCGTCGTCGGTGCAAGAGCAGCAGCCGGAGCCGGAGCCAGCAGCGCC
CCTGGGAGGCGAGGCCCGTTGGGGTCGGCCTCGCCGGCGCCCTGATGAAC
GGCGACGCTGAGGCCCTCCCACCCGCGGCGACGGTACTGACGACAGGACA
GAGGATCCGGCCGTGCCGGACCTCCGCGCTGGCGGGCTCCCCCGAAAGCA
GGAGACGGTGCGTCTTGTCGCCGAGGGAGGTGATGGAAGCGTCGGAGGAC
TACACCCGCGTCATCGCGCGCGGGCCCAACCCGAGGACGACGCACATATT
CGACGACCGCGTCGTCGTCGTGGAGGACGAGTTCCTGAGGTGGTGCCATG
GCTGCAGCAAGGACCTGGGCCAGGGCAACGACATCTTCATGTACAGGGGG
GAGATGGCCTTCTGCAGCCACGAGTGCCGCTACCGCGAGATGCTGCTCTT
CGACGAAGAAGAAGAATCCAGCTGA
back to top

protein sequence of Sh_009I06_p000050

>Sh_009I06_p000050 ID=Sh_009I06_p000050|Name=Sh_009I06_p000050|organism=R570 Sugarcane cultivar|type=polypeptide|length=275bp
MLGRMPGPGGGGVSEQREAACDFGRHTGTAAVPSLPPSPIVPPTLFLAAG
SGVVVSGEEALFSPPAELAGAGVVMVSPTSTLQAPTGGSPTSAASTAVPF
SRRGATTTSSSSGGDYVDRRRCKSSSRSRSQQRPWEARPVGVGLAGALMN
GDAEALPPAATVLTTGQRIRPCRTSALAGSPESRRRCVLSPREVMEASED
YTRVIARGPNPRTTHIFDDRVVVVEDEFLRWCHGCSKDLGQGNDIFMYRG
EMAFCSHECRYREMLLFDEEEESS*
back to top

mRNA from alignment at Sh_009I06:104663..106278+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_009I06_t000050 ID=Sh_009I06_t000050|Name=Sh_009I06_t000050|organism=R570 Sugarcane cultivar|type=mRNA|length=1616bp|location=Sequence derived from alignment at Sh_009I06:104663..106278+ (R570 Sugarcane cultivar)
GTGGTCCTACTGCAGCAGTGCATCTGTGCATGCAATCGGACGGGCATGTA TGGGCTCCTCATCTCCTCTCGCTCGCACTCACACTCGCCCTCTGCATGAC TGCATGTGAAAAGGTTCAGCTGCATGCATGTATTTAACAGGCAGAGGCAG GTATCATCAGCATTGCCCATTGCTTGATTTCTCCATACTGCTAGTAGCTG GTAAGCAAAGCAAAAACCAGTGTCCATGCATCCTATATATTAGTTTTTTA TTTATACAGCATGCACGATCCTGAGTCCTGATCGACCGCGTCTCCATGGC ATTTTTGCAGCTAGCACGCTGTGATCACGGTGTAACTATCGCCGAAAGCG GGAGCTCAGCTGACGAAGATGTTGGGGAGGATGCCTGGGCCAGGTGGCGG CGGAGTCTCGGAGCAGCGCGAGGCCGCGTGTGATTTCGGCCGCCACACGG GCACCGCCGCAGTTCCGTCGTTGCCGCCATCTCCCATCGTACCTCCGACG CTGTTCTTGGCTGCAGGGAGCGGCGTCGTCGTCTCCGGAGAGGAGGCGTT GTTCTCGCCGCCGGCGGAGCTAGCGGGGGCCGGCGTCGTGATGGTGAGCC CCACCTCCACGCTGCAGGCACCGACCGGCGGCAGCCCCACGTCTGCGGCG AGCACGGCCGTTCCGTTCTCCCGCCGCGGGGCGACGACCACCTCATCATC ATCAGGCGGGGATTATGTAGATCGTCGTCGGTGCAAGAGCAGCAGCCGGA GCCGGAGCCAGCAGCGCCCCTGGGAGGCGAGGCCCGTTGGGGTCGGCCTC GCCGGCGCCCTGATGAACGGCGACGCTGAGGCCCTCCCACCCGCGGCGAC GGTACTGACGACAGGACAGAGGATCCGGCCGTGCCGGACCTCCGCGCTGG CGGGCTCCCCCGAAAGCAGGAGACGGTGCGTCTTGTCGCCGAGGGAGGTG ATGGAAGCGTCGGAGGACTACACCCGCGTCATCGCGCGCGGGCCCAACCC GAGGACGACGCACATATTCGACGACCGCGTCGTCGTCGTGGAGGACGAGT TCCTGAGGTGGTGCCATGGCTGCAGCAAGGACCTGGGCCAGGGCAACGAC ATCTTCATGTACAGGTGAGTGCTTTAGTTATCTTGTGCTTCCTCCAGTTC CATCCTTGTTGATTGAAGCTGGTGGCGGCGGATTCTTGCAGGGGGGAGAT GGCCTTCTGCAGCCACGAGTGCCGCTACCGCGAGATGCTGCTCTTCGACG AAGAAGAAGAATCCAGCTGACGCACCAACCAAGGTGTGGTGGCATGTTAA TTTCAATCAGAAGATCGAAGACGTGTGTGCCGCCGGCCGGAGGAGAAGAC CCCGATCCTACATGATGCTGCAGCTGCACTATGGAGTACTCTGCTTCATT CGTTCTGCGTTCCTGGGTGCTAGTACTACTGCTAGATAGGTTACTCGATC TTTAGTTATCTCGGACTTCAGGTGTCAAAAAACGTACGTGCTCCTGTCAC TGCATTAGCTGTTGATCACTTATTAGGACTCCCCTGTGCCACTGGTCGCC TCCCCGGTTCGATCAAGATGATGTATCGTTGGGTAATTAACAAACGAAGC CGGCCTCCTTATTATT
back to top

Coding sequence (CDS) from alignment at Sh_009I06:104663..106278+

>Sh_009I06_t000050 ID=Sh_009I06_t000050|Name=Sh_009I06_t000050|organism=R570 Sugarcane cultivar|type=CDS|length=825bp|location=Sequence derived from alignment at Sh_009I06:104663..106278+ (R570 Sugarcane cultivar)
ATGTTGGGGAGGATGCCTGGGCCAGGTGGCGGCGGAGTCTCGGAGCAGCG
CGAGGCCGCGTGTGATTTCGGCCGCCACACGGGCACCGCCGCAGTTCCGT
CGTTGCCGCCATCTCCCATCGTACCTCCGACGCTGTTCTTGGCTGCAGGG
AGCGGCGTCGTCGTCTCCGGAGAGGAGGCGTTGTTCTCGCCGCCGGCGGA
GCTAGCGGGGGCCGGCGTCGTGATGGTGAGCCCCACCTCCACGCTGCAGG
CACCGACCGGCGGCAGCCCCACGTCTGCGGCGAGCACGGCCGTTCCGTTC
TCCCGCCGCGGGGCGACGACCACCTCATCATCATCAGGCGGGGATTATGT
AGATCGTCGTCGGTGCAAGAGCAGCAGCCGGAGCCGGAGCCAGCAGCGCC
CCTGGGAGGCGAGGCCCGTTGGGGTCGGCCTCGCCGGCGCCCTGATGAAC
GGCGACGCTGAGGCCCTCCCACCCGCGGCGACGGTACTGACGACAGGACA
GAGGATCCGGCCGTGCCGGACCTCCGCGCTGGCGGGCTCCCCCGAAAGCA
GGAGACGGTGCGTCTTGTCGCCGAGGGAGGTGATGGAAGCGTCGGAGGAC
TACACCCGCGTCATCGCGCGCGGGCCCAACCCGAGGACGACGCACATATT
CGACGACCGCGTCGTCGTCGTGGAGGACGAGTTCCTGAGGTGGTGCCATG
GCTGCAGCAAGGACCTGGGCCAGGGCAACGACATCTTCATGTACAGGGGG
GAGATGGCCTTCTGCAGCCACGAGTGCCGCTACCGCGAGATGCTGCTCTT
CGACGAAGAAGAAGAATCCAGCTGA
back to top