Sh_009I06_t000060

Overview
NameSh_009I06_t000060
Unique NameSh_009I06_t000060
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1365
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_009I06contigSh_009I06:109875..113424
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NotePentatricopeptide repeat-containing protein At1g03100, mitochondrial
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_009I06_g000060Sh_009I06_g000060R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_009I06_p000060Sh_009I06_p000060R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_009I06_t000060 ID=Sh_009I06_t000060|Name=Sh_009I06_t000060|organism=R570 Sugarcane cultivar|type=mRNA|length=1365bp
ATGTCTTCCCGATATATATTGGAGACAATGAGGACACGTTCAAGGAATAT
GCTTTGTGTTGGAAGAATTTGTTCAAGATATTATTCAAGCCATGCTGTAT
CTTCATTACTTGTGGGTCCACGACGTTTGTTTGCTTGTGAAAGCTATGTC
GACTCCAAGTGTCATGGGACTAACCAAAGTAGGGATAATAGTACCAAAAT
CTTGAAACCGGAGCTAAATATTGGTAGTTGTGGCGCTTGCTTTTCCACTG
TGACAGGAACCATTTTAGTCCAAGCTCATGATCCATCTCAGCTAGCATTG
GAGATAGAGAATGCAATTGATCAGCAGAGATTTGATGATGCATGGAGGGC
TTATGAGAAGCATGTTCACATGGATGGACTTCCAAGAAAGTCCGTTTTAA
GCAAGCTCATCTCTGGCTTGGCAGAGAGCTGTGATCCTTACCGGCTTAAG
CAGTCCTACAATGTGGTTAGTCATGCATTTGAAGAGAAGCAAGAATTGTT
GGATAAGGAACCCCTAATTTACCTATCCCTCATTCTTTCACGCTGTGATC
TGCCAAATCTTGCTATAAATGTTGTGAGGAAGTTGGTAAAGATGGAAGCA
TACCCACCTGTTGCAGCATGGTCGGCAATTTTAGCTCATATGTGTCAAAC
TAACACTGGTGCATTTCTCGGTGCAGACCTCGTAATGGAGCTTGGTTATC
TTTTCCAGAATAATAGAGTTGATCCACGGAAGAAGAGTAACCGTCCTTTG
CTATCAATGAAACCCAATTCATTTACATTCAACATAGTTCTGACTGCATC
CCTCGTGTTTGGCACTACAAGAAAAGCAGAGCAGCTTCTCGAACTAATGC
CTAGGATAGGGGTGAAGCCTGAAGTCAACTTGTTGATTGTTATGGCCCAC
ATATATGAAAGGAATGGGCACAGAGATGAGATTCAGAAGTTAAAGAGGCA
TGTTGATGAAGCTTGTGGTCTTAGTGAATCAGAGTTCAGGCAGTTTTATG
ATTGCTTGCTCTCCTGTCATTTGAAATTTGGAGATTTGGATCATGCAGTT
GATATGATGTTGGATATGCTTAGGAAAGCTAAGAATGCAAAGCGGTCATT
GGAAGCAGCTAAAGCAGTTCTTGAAGCTGTTAAAAATAGAAAAATTTATT
TTCCTTATGAGAAAACTGATGCTGAAAACCCATGCTCTTCTAATAGCCAA
ATGCTAAGTTATGCTGCATTCTTCAAAGACAACAGCTTTGCGAGACTTGA
ATTGGATGCAAGAGAATTAGTCAGGCTATTAACAGATAAGCTGCAGAAAC
ATGTTGGACTGGTGAAATCTGAGCATGGCATTCTCCATCCAACTGAAACA
ATGTATGCCAAGCTT
back to top

protein sequence of Sh_009I06_p000060

>Sh_009I06_p000060 ID=Sh_009I06_p000060|Name=Sh_009I06_p000060|organism=R570 Sugarcane cultivar|type=polypeptide|length=455bp
MSSRYILETMRTRSRNMLCVGRICSRYYSSHAVSSLLVGPRRLFACESYV
DSKCHGTNQSRDNSTKILKPELNIGSCGACFSTVTGTILVQAHDPSQLAL
EIENAIDQQRFDDAWRAYEKHVHMDGLPRKSVLSKLISGLAESCDPYRLK
QSYNVVSHAFEEKQELLDKEPLIYLSLILSRCDLPNLAINVVRKLVKMEA
YPPVAAWSAILAHMCQTNTGAFLGADLVMELGYLFQNNRVDPRKKSNRPL
LSMKPNSFTFNIVLTASLVFGTTRKAEQLLELMPRIGVKPEVNLLIVMAH
IYERNGHRDEIQKLKRHVDEACGLSESEFRQFYDCLLSCHLKFGDLDHAV
DMMLDMLRKAKNAKRSLEAAKAVLEAVKNRKIYFPYEKTDAENPCSSNSQ
MLSYAAFFKDNSFARLELDARELVRLLTDKLQKHVGLVKSEHGILHPTET
MYAKL
back to top

mRNA from alignment at Sh_009I06:109875..113424+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_009I06_t000060 ID=Sh_009I06_t000060|Name=Sh_009I06_t000060|organism=R570 Sugarcane cultivar|type=mRNA|length=3550bp|location=Sequence derived from alignment at Sh_009I06:109875..113424+ (R570 Sugarcane cultivar)
TCCCGCTCGCCCGGTCGCCACGTCCGCTTCCGGCGTCCGGCGCTGCCTGC CCCTTCTCCTTTCCTCCCCAAGCCGGCACGCCGCCTCCTGCAGTCCTGCC CGCCGCCCGCCTACTACCGGCTGCCGGCCGTCGTCCTCCGACGACGACTC TTGGAGATCTGGCCGTCCATCAAGTGGGACAAGGGCAACGCCATACAGTT CTTGCGTGAGTCTCTCGGTGAGTGCATATTCTTTTCTCTTTCAAATCCTG CCTTTTGGATTTGGGTTTTGGAGCCATGAAATTGCTCGCTGCTGATGAGG TGCTAAATAATTTGCCTGCCTTGGTTTCCTCAAGATTTTGCTGACAGTAA CAATGTCTTCCCGATATATATTGGAGACAATGAGGACACGTTCAAGGTAA TGCCCCAATCCCCAGTAATAAAGAAGTGGCCTTTTGTATATTGATGATAT GGTTATTTTCCGACATATAACTTTGACAAACAATTCATATGTTTACACGA AGGAATTGTTGACCAATAGGTAGCAATACTATCGACCGCTACTAGTTACA ATGCACAGACTACCTAGTTCAGCTGTGGTTGTAGCCAAAAATGGAGTTAG GCACAGGCCATGTACGCATGGCCCCAAGTGCTCGCTGTTGATTTAAGTTC GAATTGGACCCCTCCTTTTCTAGCCTTCTATTATTCAGCCCCTCCATTCC CCGGTCCGCTTCTGGATCCGCCACCTGATAAGATCAATCAGGAGCAGCAC CCATTCCAATTTTATGTTCTTCCCATCAGCTAAATTGGCAATTCTTAACC TGCTATGATTGTTAACCGAACAAAAGAAAAAGAAATAGATCCCGAACTAT CAATACTGAACCTTGCTTTTGTCCTTTTTCTTATTGCAAATCATAGTTTC CCTGGGACACCGCAGCTGACTGTGTCTCGACTGTCACAGCACAAGCAGTA GTATTAGAAAGCTATTTGAAAAATCATGTTCAAACATTTCAAAGATATAA GAGAAGATTCAGTGTCTTTAAAATTATGCTCAAGAGTCAGATCAGACTTG GTTGTAATACCCTGCAACTGTCACTGATAACAGTTGTTTCATAGAACAAG CTATTATCTACTTTTACCTGTAACTTTTTGTAAATTTGTTTGTGGATGAG TTCAAGTGAAAGTAGTGGGAAAGGGGATGAGGCTATATTTAAGATTGCAT GTAGTCAACAGGATGTGCTTAAACAATATGAGCTTTGTTTGCTATGCCTA TGAGACAATAGTTTCCATGAGAGGCCATTTGTAAGGACAAAGGTACTATT GTGGGGATGACATACAATTTAATATTTCAATTGAGAAAGAAATCGTAATT CAAACTATGTGGGAGTCTGAAAAAATATGGCAAACAACGATACAAAAGGA TAAACCAAACTAAATATACACTCAGAACAGCTGGGGTTATTATAGACAAT TGCACAACAAAACAACAATCAAACCCTCTTACAAGTTACAGTCCAGCTTA TTACAAACTAGCTTTTAACTATCTGCAATGCAGAAGCTAATTTTTACAAT CTGCAACTACAACAAACAAGGCCTAAAAGTGCAGCATGAAGAAGATGAAC TGTCCTATCCGTCCTTGTTTCAATTAGGGTTTTCTTCTTCAGGGGCATAC CCGAGGTGTGGCAGCAGTTTATTTTCACACAAAGGACCTGTTTGGCTCAT GGCCGCAGCACACCATGACCCAACTGTGGCATGCCGCATCTCGTGCGTTC TGAAAGTGCGGCACCCTTCACTGTGTATTCCTATGCTGATTCTTGCCAAA CGTGCGGTGTTTGTTTTTTTTCGCCACACTTGTGGTGCGGTCAGACTTGT GGCATAGCAACGTACAGCAGGAGCCAAACTGGCCCAAAAAGATACATTCT CAACGCAGAGTGCTAAACCAATTATGATGCGAACATTAACATGGAAAGTT TTTCATATATGACTACCCTTGTAAAGCTAGTAAGCTACTTTGGTTGCAAT GTACCCCTTTTGCTAAATTGGCTGTGTCATCTACCCAGTTTCAGTTGTTT GTCTCACTACGTAGCGTTCTGATTTCCTGCTGTGATCCTTGTTTCGCTTA CTGTCCTAGCAGTTGAGACTGGGTATTATTGAAGTCCATCGATTCTAACG GTGTAACCTGCTGCAATAAAAAATAGCATTGACTCATTGTTTCGAGTTCT TTCTGTTTGACCCTAGTTATCTGCTGCAGGAATATGCTTTGTGTTGGAAG AATTTGTTCAAGATATTATTCAAGCCATGCTGTATCTTCATTACTTGTGG GTCCACGACGTTTGTTTGCTTGTGAAAGCTATGTCGACTCCAAGTGTCAT GGGACTAACCAAAGTAGGGATAATAGTACCAAAATCTTGAAACCGGAGCT AAATATTGGTAGTTGTGGCGCTTGCTTTTCCACTGTGACAGGAACCATTT TAGTCCAAGCTCATGATCCATCTCAGCTAGCATTGGAGATAGAGAATGCA ATTGATCAGCAGAGATTTGATGATGCATGGAGGGCTTATGAGAAGCATGT TCACATGGATGGACTTCCAAGAAAGTCCGTTTTAAGCAAGCTCATCTCTG GCTTGGCAGAGAGCTGTGATCCTTACCGGCTTAAGCAGTCCTACAATGTG GTTAGTCATGCATTTGAAGAGAAGCAAGAATTGTTGGATAAGGAACCCCT AATTTACCTATCCCTCATTCTTTCACGCTGTGATCTGCCAAATCTTGCTA TAAATGTTGTGAGGAAGTTGGTAAAGATGGAAGCATACCCACCTGTTGCA GCATGGTCGGCAATTTTAGCTCATATGTGTCAAACTAACACTGGTGCATT TCTCGGTGCAGACCTCGTAATGGAGCTTGGTTATCTTTTCCAGAATAATA GAGTTGATCCACGGAAGAAGAGTAACCGTCCTTTGCTATCAATGAAACCC AATTCATTTACATTCAACATAGTTCTGACTGCATCCCTCGTGTTTGGCAC TACAAGAAAAGCAGAGCAGCTTCTCGAACTAATGCCTAGGATAGGGGTGA AGCCTGAAGTCAACTTGTTGATTGTTATGGCCCACATATATGAAAGGAAT GGGCACAGAGATGAGATTCAGAAGTTAAAGAGGCATGTTGATGAAGCTTG TGGTCTTAGTGAATCAGAGTTCAGGCAGTTTTATGATTGCTTGCTCTCCT GTCATTTGAAATTTGGAGATTTGGATCATGCAGTTGATATGATGTTGGAT ATGCTTAGGAAAGCTAAGAATGCAAAGCGGTCATTGGAAGCAGCTAAAGC AGTTCTTGAAGCTGTTAAAAATAGAAAAATTTATTTTCCTTATGAGAAAA CTGATGCTGAAAACCCATGCTCTTCTAATAGCCAAATGCTAAGTTATGCT GCATTCTTCAAAGACAACAGCTTTGCGAGACTTGAATTGGATGCAAGAGA ATTAGTCAGGCTATTAACAGATAAGCTGCAGAAACATGTTGGACTGGTGA AATCTGAGCATGGCATTCTCCATCCAACTGAAACAATGTATGCCAAGCTT
back to top

Coding sequence (CDS) from alignment at Sh_009I06:109875..113424+

>Sh_009I06_t000060 ID=Sh_009I06_t000060|Name=Sh_009I06_t000060|organism=R570 Sugarcane cultivar|type=CDS|length=1365bp|location=Sequence derived from alignment at Sh_009I06:109875..113424+ (R570 Sugarcane cultivar)
ATGTCTTCCCGATATATATTGGAGACAATGAGGACACGTTCAAGGAATAT
GCTTTGTGTTGGAAGAATTTGTTCAAGATATTATTCAAGCCATGCTGTAT
CTTCATTACTTGTGGGTCCACGACGTTTGTTTGCTTGTGAAAGCTATGTC
GACTCCAAGTGTCATGGGACTAACCAAAGTAGGGATAATAGTACCAAAAT
CTTGAAACCGGAGCTAAATATTGGTAGTTGTGGCGCTTGCTTTTCCACTG
TGACAGGAACCATTTTAGTCCAAGCTCATGATCCATCTCAGCTAGCATTG
GAGATAGAGAATGCAATTGATCAGCAGAGATTTGATGATGCATGGAGGGC
TTATGAGAAGCATGTTCACATGGATGGACTTCCAAGAAAGTCCGTTTTAA
GCAAGCTCATCTCTGGCTTGGCAGAGAGCTGTGATCCTTACCGGCTTAAG
CAGTCCTACAATGTGGTTAGTCATGCATTTGAAGAGAAGCAAGAATTGTT
GGATAAGGAACCCCTAATTTACCTATCCCTCATTCTTTCACGCTGTGATC
TGCCAAATCTTGCTATAAATGTTGTGAGGAAGTTGGTAAAGATGGAAGCA
TACCCACCTGTTGCAGCATGGTCGGCAATTTTAGCTCATATGTGTCAAAC
TAACACTGGTGCATTTCTCGGTGCAGACCTCGTAATGGAGCTTGGTTATC
TTTTCCAGAATAATAGAGTTGATCCACGGAAGAAGAGTAACCGTCCTTTG
CTATCAATGAAACCCAATTCATTTACATTCAACATAGTTCTGACTGCATC
CCTCGTGTTTGGCACTACAAGAAAAGCAGAGCAGCTTCTCGAACTAATGC
CTAGGATAGGGGTGAAGCCTGAAGTCAACTTGTTGATTGTTATGGCCCAC
ATATATGAAAGGAATGGGCACAGAGATGAGATTCAGAAGTTAAAGAGGCA
TGTTGATGAAGCTTGTGGTCTTAGTGAATCAGAGTTCAGGCAGTTTTATG
ATTGCTTGCTCTCCTGTCATTTGAAATTTGGAGATTTGGATCATGCAGTT
GATATGATGTTGGATATGCTTAGGAAAGCTAAGAATGCAAAGCGGTCATT
GGAAGCAGCTAAAGCAGTTCTTGAAGCTGTTAAAAATAGAAAAATTTATT
TTCCTTATGAGAAAACTGATGCTGAAAACCCATGCTCTTCTAATAGCCAA
ATGCTAAGTTATGCTGCATTCTTCAAAGACAACAGCTTTGCGAGACTTGA
ATTGGATGCAAGAGAATTAGTCAGGCTATTAACAGATAAGCTGCAGAAAC
ATGTTGGACTGGTGAAATCTGAGCATGGCATTCTCCATCCAACTGAAACA
ATGTATGCCAAGCTT
back to top