Sh_009J10_p000010

Overview
NameSh_009J10_p000010
Unique NameSh_009J10_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length414
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_009J10contigSh_009J10:462..2645
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR012864
InterProIPR011051
InterProIPR014710
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_009J10_t000010Sh_009J10_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_009J10_p000010 ID=Sh_009J10_p000010|Name=Sh_009J10_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=414bp
MKTTVEGSGGAPAAVKRRRRDAPGRRRSGSVSVRRRVQVDATTAPAPLQR
LLAACRRAFGGPGTVPSPDDVALIRDILGKYAAPPRPALPSSLAIALHDA
RCICLTNYCLVCYCSVIVSSGTLWHFKLKVVQFKSCEISDLSSVYARCVN
PISLHATSNLVLTRKEHRSYRRPRHQPSIRLAYKMGAEDVHLRVVTKAAA
ASFPRTHPTPIITRTTIYKCKNFSIVIFLLPPGAVIPLHDHPGMTVFSKL
LLGSLHVTSYDWVDAEDGPPTAVGGGGDRLLRLAKRVVDADLSAPCDALV
LFPESGGNMHRFAAATACAVLDVLGPPYSGDRDCTYYQDLPYRHHHHDDD
AGNEAAGDGDVVPAATDDEQKPRLGWLLETRKPKELHMYEVPYRGPPILW
KKRPTVDSWQQGP*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016702oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process