Sh_009J10_p000020

Overview
NameSh_009J10_p000020
Unique NameSh_009J10_p000020
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length705
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_009J10contigSh_009J10:29172..31597
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR025287
InterProIPR017441
InterProIPR000719
InterProIPR018097
InterProIPR000742
InterProIPR008271
InterProIPR001245
InterProIPR001881
InterProIPR011009
InterProIPR000152
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_009J10_t000020Sh_009J10_t000020R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_009J10_p000020 ID=Sh_009J10_p000020|Name=Sh_009J10_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=705bp
MLLPAFLLQPLLLACFFSSFVHPMEPNTSRSWCANMSIPYPFGIAGDGGS
PFLSQGFQISCRSRRSAALSGPALPIGNRVFGILDISLLDGFVTIAANAS
SQQCKGNSSFNLEGTIFTYSDTRNKFTALGCNVVAMLLNGSSGYSGGCAS
FCSSKDNIVNGSCSGVACCQAPVPKGLTKMELEFNIISNKYNSTPPCGEA
FIVEQNSCEEAQQSTSYACRENTYCYNSPNGIGYRCNCSDGFQGNPYLPG
PGGGCQDIDECTTRNPCTYKCVNTKGGFHCRCPAGMSGDGFKEGSGCNGV
GTLTIAGVTGLALLVLLFILGFWTHWLVKKRKLAKTRQRYFMQNGGLLLK
QQMFSERAPLHIFTSSELDKATSNFSDDNIIGRGGFGTVYKGILSNQMVV
AIKKAQRVDQTQMEQFVNELIILSQANHKHVVQLLGCCLETEVPLLVYEF
ITNGALFHHLHNTLAPMSWENRLSIAVETASALAYLHLATKMPIIHRDVK
SSNILLDENFTAKVSDFGASRPIPYNQTHVTTLVQGTLGYLDPEYFQTSQ
LTEKSDVYSFGVVLIELLTRKKPIMDGMMEDMRSLALQFSMLFHQNKLLE
IVDPTVSEEAGMRHIETVAKLALRCIKLKGEERPRMIEVAIELEALRRLM
KQHFIMKSESLLHESWCHEEMSIDAPSNFCLGDDGILGDESQEIILLPSN
SLSS*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0030247polysaccharide binding
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0005509calcium ion binding
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation