Sh_009J10_t000040

Overview
NameSh_009J10_t000040
Unique NameSh_009J10_t000040
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length348
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_009J10contigSh_009J10:73723..74070
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NotePutative protein
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_009J10_g000040Sh_009J10_g000040R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_009J10_p000040Sh_009J10_p000040R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_009J10_t000040 ID=Sh_009J10_t000040|Name=Sh_009J10_t000040|organism=R570 Sugarcane cultivar|type=mRNA|length=348bp
ATGGTTGGGGGCTCCAAAGCACCACCGCCGTCATCCCTTCTTTTCCTGGC
CTACCAAGTTGCGGGGTTCATGAACATCGCCGCAAGTTTCTTCAACCATC
ATACATGTGCCTCTTCTTCTTTATCGATCGTTTCCCTCATCTCTTATACT
GACTTCGCTACGGATACACCACCGAGATATTATCAAAAGATCAGCAACCT
CCCCCAACCCAATCTGGTGGGGGCATCTTCAAGCCGCCACCCAACATCGT
CACTTGCCACCACATCACAGGTAATAAACTACATTTATTTCATGAATATT
CCAGCAATTCACTTACTTTTTTACCTGGGCATTCAATATATTCTCTAA
back to top

protein sequence of Sh_009J10_p000040

>Sh_009J10_p000040 ID=Sh_009J10_p000040|Name=Sh_009J10_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=116bp
MVGGSKAPPPSSLLFLAYQVAGFMNIAASFFNHHTCASSSLSIVSLISYT
DFATDTPPRYYQKISNLPQPNLVGASSSRHPTSSLATTSQVINYIYFMNI
PAIHLLFYLGIQYIL*
back to top

mRNA from alignment at Sh_009J10:73723..74070+

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_009J10_t000040 ID=Sh_009J10_t000040|Name=Sh_009J10_t000040|organism=R570 Sugarcane cultivar|type=mRNA|length=348bp|location=Sequence derived from alignment at Sh_009J10:73723..74070+ (R570 Sugarcane cultivar)
ATGGTTGGGGGCTCCAAAGCACCACCGCCGTCATCCCTTCTTTTCCTGGC CTACCAAGTTGCGGGGTTCATGAACATCGCCGCAAGTTTCTTCAACCATC ATACATGTGCCTCTTCTTCTTTATCGATCGTTTCCCTCATCTCTTATACT GACTTCGCTACGGATACACCACCGAGATATTATCAAAAGATCAGCAACCT CCCCCAACCCAATCTGGTGGGGGCATCTTCAAGCCGCCACCCAACATCGT CACTTGCCACCACATCACAGGTAATAAACTACATTTATTTCATGAATATT CCAGCAATTCACTTACTTTTTTACCTGGGCATTCAATATATTCTCTAA
back to top

Coding sequence (CDS) from alignment at Sh_009J10:73723..74070+

>Sh_009J10_t000040 ID=Sh_009J10_t000040|Name=Sh_009J10_t000040|organism=R570 Sugarcane cultivar|type=CDS|length=348bp|location=Sequence derived from alignment at Sh_009J10:73723..74070+ (R570 Sugarcane cultivar)
ATGGTTGGGGGCTCCAAAGCACCACCGCCGTCATCCCTTCTTTTCCTGGC
CTACCAAGTTGCGGGGTTCATGAACATCGCCGCAAGTTTCTTCAACCATC
ATACATGTGCCTCTTCTTCTTTATCGATCGTTTCCCTCATCTCTTATACT
GACTTCGCTACGGATACACCACCGAGATATTATCAAAAGATCAGCAACCT
CCCCCAACCCAATCTGGTGGGGGCATCTTCAAGCCGCCACCCAACATCGT
CACTTGCCACCACATCACAGGTAATAAACTACATTTATTTCATGAATATT
CCAGCAATTCACTTACTTTTTTACCTGGGCATTCAATATATTCTCTAA
back to top