Sh_009J10_t000070

Overview
NameSh_009J10_t000070
Unique NameSh_009J10_t000070
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length597
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_009J10contigSh_009J10:95286..98338
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
Noteweakly similar to Myb family transcription factor-like
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_009J10_g000070Sh_009J10_g000070R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_009J10_p000070Sh_009J10_p000070R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_009J10_t000070 ID=Sh_009J10_t000070|Name=Sh_009J10_t000070|organism=R570 Sugarcane cultivar|type=mRNA|length=597bp
ATGTTGAACAATAAACCAGCACAAAGCAATGATGTTCCTGACATGTCAAG
CATGGTGGCTTCTCGCATTATCTGGGCAATGCAACCAACAAGGAGTTTCT
TGCGGTGGTCTGATGATCTCCATATGATCTTTGTGAAAGCCGTGGCATAT
CAAGGCGGACCCCATGAAGCTAAACCGGCTGCCCTGCAGAAGACAATGGA
AGCTATGGGGGTCAGAGGCCTCACAATAAAAAAGATCAAGAGTCACCTCC
AGAGATACAGGGAGAAGTGTGTTTTAGGACCTGAAGCTCCTGATGATATA
CCACGAGCCACATCATCTAGCATAGCAGCACCTAATATGGCTTCTGAGAT
ACTGATGGACACTGAGGCAGTTATGCCAGAAATAGAGGTGGTGAACAGTT
TTCTTATGGATGACACAGAGATGGTGGATAACAACTTTTCTGTGGACCAG
GTACAGATGGTGGAGAAGGAGCTGATGAATGAAATACAGTTGATTGAGCG
CCACTCGAAGTGTTCGCAGACTGCGATTGATGAATACATGGATGGCTTGG
CTGACTATGCATTCGGCCATTTGGACTACCCAAATTTCAACCTGTGA
back to top

protein sequence of Sh_009J10_p000070

>Sh_009J10_p000070 ID=Sh_009J10_p000070|Name=Sh_009J10_p000070|organism=R570 Sugarcane cultivar|type=polypeptide|length=199bp
MLNNKPAQSNDVPDMSSMVASRIIWAMQPTRSFLRWSDDLHMIFVKAVAY
QGGPHEAKPAALQKTMEAMGVRGLTIKKIKSHLQRYREKCVLGPEAPDDI
PRATSSSIAAPNMASEILMDTEAVMPEIEVVNSFLMDDTEMVDNNFSVDQ
VQMVEKELMNEIQLIERHSKCSQTAIDEYMDGLADYAFGHLDYPNFNL*
back to top

mRNA from alignment at Sh_009J10:95286..98338+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_009J10_t000070 ID=Sh_009J10_t000070|Name=Sh_009J10_t000070|organism=R570 Sugarcane cultivar|type=mRNA|length=3053bp|location=Sequence derived from alignment at Sh_009J10:95286..98338+ (R570 Sugarcane cultivar)
GTGCTGCCAGCTTCCAACTGAAGAGATTAGGAACAATTCTTTTCATTAAG CGTCACTTATTTTTCTCAGAAGATAGAATGTATTACAGATGTCATCTCAT GAGAACACAGTGATGTACTCTTCTGTACAGTAGTAGCAATTTGATTACCT TATTAAAAATACTGCTGATAATTTATCATCCTTGTGCATTCTATGTCTGT ACAAATTTCAAAACCATACTTGGACAAGATTGGCTGAAATTGTATTTTGC CTGTTCTAGAGCAGATCATGATACATCTATGCACCAGATTGAACATACTC TACCTGGTTACTTACCAGAATCTCTGCAGTCCTTTGCCTACTTACTCCAC TTGCAAGTGGATGCAATGTTAAAATTATGACCTAACTGTTTGATTGATGT ACTATATTTCTTCTCCTTGTTTTTTTTAAAGCATGCAGATAGCAGGACAA CAAGATAAGGCACAACTACCTTGATGTGAAGAATTTCCACTAATGAATCC CATAAATGCTTGCTATAACTTCACTCACATCTCAAGCATGCTGCTTGCCT AATAAGTCAACCTCAGCATTAATCACGGTACCAAAATTATCATTTGCAGT GTTATGTTTCTTTGTTATCACATCCACTCATGATTTTAATAAATATGAAG AACTTCCACTAATGAATCCCATAAAGGCTACATGTGCTATAGAAAGACTG AAAGAGCACCTCATGACATCATGACATATCTGTAATTAACATTGGACAGC CACTCTTCTTGTTTTCTTATCATTTTGAGAAACCTGTACTTCCGTGCCTA ACTTTCCTTCTATGAACAGCCACTGTGATGATGGATAAGACACTACTTAT GTAGTGAGTGTAGCACTGTAGCATCTCTCGTCTCTTACAAGGAGATCTAT ATAGAGGGGGCTGATATGCTTTCTAGTTCAGGACATCATTCCTCACCCTT CTAGTTCTCCCTGGAAGAAAGGATACACCCTCAATTCCTTTTGCTTCCTA AGTTCTCACTGGAAGAACAGAAGGCTAAAATCAATTCGCTTCATCACATA TATATAGGTATGATTACTGATGCTTTTTCTCTTCCGCAGCATTTGGCTTC TGTTTAATCTCAGTTTTCCCTTTTGGAAATCTTTCAGTGTCCACTTTTAC TCATATAACAGTGGGGGCTCGGGTAAAAAAAAAACTTTTACTCATAATAT ACACAAATTGAGGGGTTCTGTCTTTTTAATTACAAAAGGCAAACTGCTTG GTTTCCTTTATCTTTACTGAACATTTGTGAGATTGATTTTCAGAATAATG TTGAACAATAAACCAGCACAAAGCAATGATGTTCCTGACATGTCAAGCAT GGTGGCTTCTCGCATTATCTGGGCAATGCAACCAACAAGGAGTTTCTTGC GGTGGTCTGATGATCTCCATATGATCTTTGTGAAAGCCGTGGCATATCAA GGCGGACCCCATGGTTTGGCTTCTTGACATTTGATCATACCTTGATTTGA TCTTTGGGGTGGCGGGCTCCCTTTTTCGTCCCTTCAATCTTTTGTTGTTC TATAAAGCTGATGCTGTGTCATGCAATTGTTACAACCTGTAGAAGCTAAA CCGGCTGCCCTGCAGAAGACAATGGAAGCTATGGGGGTCAGAGGCCTCAC AATAAAAAAGATCAAGAGTCACCTCCAGGTGCCTCTCCCTGTTTCAGATC ATTCATTGGATACCTATATCATTGCCATTCAACCATGCATGATCTCAATA AATTTTCCTTCTTGCTGTTATTTTTGTTTTCGCCAGAGATACAGGGAGAA GTGTGTTTTAGGACCTGAAGCTCCTGATGATATACCACGAGCCACATCAT CTAGCATAGCAGCACCTAATATGTGTGATTCTCCGTTTAAATAAGATTTC GATATTTCATATGTCATGCTATGTCGTTGCACCTTATGTTTAAGACATGT TTCTGATGTGCAGGGCTTCTGAGATACTGATGGACACTGAGGCAGTTATG CCAGAAATAGAGGTGAAACTTTGTTTGTGTTCCAACTGAAAATTATTAAT TACTCTCCATTAGACTTAAGATGCAAACAAAAAAATATATTATCTTATGA TTTCAATTGTGTGATGCAGGTGGTGAACAGTTTTCTTATGGATGACACAG AGGTATAGTTCCTTCACATTTCTTGTAAATGTGCTTCGTGTGTGTGTGTG GTGATGGTGACAACTTCATGGTGTCTGCTGAATCTTTCAGATGGTGGATA ACAACTTTTCTGTGGACCAGGTACAGGTATAGCCATCTTTTCCTTCATAA AACAAACCTTTATATTTGATATTGATTATTGCTGATGCTAATACGTCTAT GCTGCTTGTGTACCAAAAAAATTGTAATATAGATGGTGGAGAAGGAGCTG ATGAATGAAATACAGGTTGTTCAAAATTTCACATCAACAAATTATTGCAA CTAGTACTTGTGATGGGGCATAACTTGTACTGCTAATTTTTCCTGTGCAC AGTTGATTGAGCGCCACTCGAAGTGTTCGCAGACTGCGATTGATGAATAC ATGGATGGCTTGGCTGACTATGCATTCGGCCATTTGGACTACCCAAATTT CAACCTGTGATTCCACTGTCAAGGGTGCTCTGCCCTCAGTTTTCACGTGC CTATGAGAGACAGAGATACAAGGCTGTTTTCTGACTGAAAGCAAAATGAC TGTGATAGTTACACAGATTGTCCCTAATTATAAAGTCGTGGCAGTGCCTG CTTCTTGGAGCATGCTAGAATTGTTCTGGATTTGGAAGGGGAAGATAGAA TTGTGGGCTTAGTTCGAGCATAGTGGAGCATTTTAAATAAAATGTCTACC GTACGTTCTGCATAGTGGAGCATAGATGGTTTGAGGAGGCGCTTGTACAT GTATTGCAGGTTGTGTTCACTTGTTTGGATCTCGGATGCTTCTGTTCATG TTTTAGCAATATTGAATTCTGGAGTTGAAGTAGTTAGGCCAATGTCAATG GATGCTTCTCAGGGTGCTATGAAAACTTATTTATTCATTTACGAAAAGAG AGT
back to top

Coding sequence (CDS) from alignment at Sh_009J10:95286..98338+

>Sh_009J10_t000070 ID=Sh_009J10_t000070|Name=Sh_009J10_t000070|organism=R570 Sugarcane cultivar|type=CDS|length=597bp|location=Sequence derived from alignment at Sh_009J10:95286..98338+ (R570 Sugarcane cultivar)
ATGTTGAACAATAAACCAGCACAAAGCAATGATGTTCCTGACATGTCAAG
CATGGTGGCTTCTCGCATTATCTGGGCAATGCAACCAACAAGGAGTTTCT
TGCGGTGGTCTGATGATCTCCATATGATCTTTGTGAAAGCCGTGGCATAT
CAAGGCGGACCCCATGAAGCTAAACCGGCTGCCCTGCAGAAGACAATGGA
AGCTATGGGGGTCAGAGGCCTCACAATAAAAAAGATCAAGAGTCACCTCC
AGAGATACAGGGAGAAGTGTGTTTTAGGACCTGAAGCTCCTGATGATATA
CCACGAGCCACATCATCTAGCATAGCAGCACCTAATATGGCTTCTGAGAT
ACTGATGGACACTGAGGCAGTTATGCCAGAAATAGAGGTGGTGAACAGTT
TTCTTATGGATGACACAGAGATGGTGGATAACAACTTTTCTGTGGACCAG
GTACAGATGGTGGAGAAGGAGCTGATGAATGAAATACAGTTGATTGAGCG
CCACTCGAAGTGTTCGCAGACTGCGATTGATGAATACATGGATGGCTTGG
CTGACTATGCATTCGGCCATTTGGACTACCCAAATTTCAACCTGTGA
back to top