Sh_009J10_t000080

Overview
NameSh_009J10_t000080
Unique NameSh_009J10_t000080
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1593
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_009J10contigSh_009J10:110320..115957
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
Notesimilar to Expressed protein
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_009J10_g000080Sh_009J10_g000080R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_009J10_p000080Sh_009J10_p000080R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_009J10_t000080 ID=Sh_009J10_t000080|Name=Sh_009J10_t000080|organism=R570 Sugarcane cultivar|type=mRNA|length=1593bp
ATGGCCCCCTCCGCCAGCGAAGCCACCTCGTCGTCGGCGACCAGTGCCAC
CTCGTCCTCGGACGCCGACGCCCCGGCCTCCCCCTCGCCGTCCCCGTCCC
GGCGCGCGGTGCCCACTCTGCTCCTCGTCTCCTTCTTCGCCGCGCTCCTC
GTCCTCTCCTCCGGCGACGATGCCACGGCGCAGCCGCTCAACGGTGTTAG
CTTGGAAAATCCAGAGGTTTCATTTGTTCCTTCCCCCTTGGATGGACAAT
TTTGTGAGCGAGTCCTCCTATCTGGAGTGCCAAGGTTACATCTTGATAGC
TATGCAAGCCAAATTCGTGTCAAAATGAATGTCTCTCAGTCGATTCCTGA
GAAGTTCCATTGGAAAATAGAGGTTTGCTTCCATAGGAATGCCTCCATGG
ATTTATGCCAGTGCGAGGCTGGTGAATGGCAAGGTTTTCAAGATGGGATG
TGGACTGCTTTAAATTCTCCATATGGAAACAAATATGTTGATGTGAAATT
GGCTGATAAGAAACCTGCTAGGTTCACTCTTTCCATTCAGGAAGAGTTTC
AGAAATGGCGTTTGGCTTGCCTTGGTATTGGATTTGTATTGCTATTCCTC
TCACCAATTGTTAGCAAATGGGCTCCCTTTTACTATAGCAGCTCTATGGC
TCTTGGGATCCTGTTTGTTGTTCTTATTGTACTTTTTCAGGGGATGAAAT
TGCTACCAATGGGCAGGAAAAGTTTATTTTACCTTGCAATTTATGGATCT
GTGTTAGGTGTTGGTTCCTATGTTGTACACTACTTCTCAACATTGGTCTC
TTCTATTCTCGAAAACTTCGGCTTGAGTGAAGAGTTGTACAACCCTGTTT
CTATCTTCCTGCTGGTGGCAATTGTCTTCACTGGAGCTGGTTTTGGCTAT
TGGATGGTCAGGAGATTTATCCTTTCAAAAGATGGAAGTGTAGATGCTGG
GATAGCGCAATTTGTAAAGTGGGCTATGCGTGTTGTTGCTACATTATTCA
TTATGCAGAGCACACTTGATCCTCTTCTAGCACTGGTTTCTCTTGCTTTT
AGCTGGTGGTTATGCTCTTTGTTGACTGCAAAGAAAGTTCAGAAGACAAT
GACCCAGAAACAAAAGCAGTCAATGGTTCTTTCTCACCAAATGCTTACTC
AAGGATTGCCCAAGAGTCCTAAAATCCAGTTCTTAAGTCCATCTAAGATA
GGCTTTGGAAGAACCACATCTAGAAGTTCCGCCACACAGTACGGTCGGAG
CAATTTGGCAAATGGAGGTCTGGTCTGCTCAGCACTTACAAAGCACGTAG
TACCCAACGAAGATGACGAAGATCACTACTCTACCTTCCACAACATCCAG
CCACGGAAATATTCCAAGGAGGAATGGGAGGACTTCACCCAGAAATCGAC
TAGGAAGGCACTTGCGGAGTGCACAGCAACCCCGGAGTTTGCCCAATGGG
TCGCTGACAATGCTCATCGTTTGCAAGTAGAGAAAGAGGAAGACAACTTC
TCAGAGGAAGAGACCATCGAGAGCTCCAACTCCTCGGAAGAAACTGGGGA
CGAAGCTGATGGAGCTCCAGGTCTGATCAGGCTGTGGGGCTAG
back to top

protein sequence of Sh_009J10_p000080

>Sh_009J10_p000080 ID=Sh_009J10_p000080|Name=Sh_009J10_p000080|organism=R570 Sugarcane cultivar|type=polypeptide|length=531bp
MAPSASEATSSSATSATSSSDADAPASPSPSPSRRAVPTLLLVSFFAALL
VLSSGDDATAQPLNGVSLENPEVSFVPSPLDGQFCERVLLSGVPRLHLDS
YASQIRVKMNVSQSIPEKFHWKIEVCFHRNASMDLCQCEAGEWQGFQDGM
WTALNSPYGNKYVDVKLADKKPARFTLSIQEEFQKWRLACLGIGFVLLFL
SPIVSKWAPFYYSSSMALGILFVVLIVLFQGMKLLPMGRKSLFYLAIYGS
VLGVGSYVVHYFSTLVSSILENFGLSEELYNPVSIFLLVAIVFTGAGFGY
WMVRRFILSKDGSVDAGIAQFVKWAMRVVATLFIMQSTLDPLLALVSLAF
SWWLCSLLTAKKVQKTMTQKQKQSMVLSHQMLTQGLPKSPKIQFLSPSKI
GFGRTTSRSSATQYGRSNLANGGLVCSALTKHVVPNEDDEDHYSTFHNIQ
PRKYSKEEWEDFTQKSTRKALAECTATPEFAQWVADNAHRLQVEKEEDNF
SEEETIESSNSSEETGDEADGAPGLIRLWG*
back to top

mRNA from alignment at Sh_009J10:110320..115957+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_009J10_t000080 ID=Sh_009J10_t000080|Name=Sh_009J10_t000080|organism=R570 Sugarcane cultivar|type=mRNA|length=5638bp|location=Sequence derived from alignment at Sh_009J10:110320..115957+ (R570 Sugarcane cultivar)
GTTAAAAAAAAAGGGAAAAAAAGGGGGTTTGCTTGAATTTGAAGCGCAGC CATATCTGCTCGGAGCGCCGCCGCGCGAGATGGCCCCCTCCGCCAGCGAA GCCACCTCGTCGTCGGCGACCAGTGCCACCTCGTCCTCGGACGCCGACGC CCCGGCCTCCCCCTCGCCGTCCCCGTCCCGGCGCGCGGTGCCCACTCTGC TCCTCGTCTCCTTCTTCGCCGCGCTCCTCGTCCTCTCCTCCGGCGACGAT GCCACGGCGCAGCCGCTCAACGGTATCGTAAACCTTCGTCTTGTTCTGCG ACTGCGTTCGTGTGTGCGCGCGCGCGCGGCGATTGTGTCTGTCTAGGGTT TAGGGCTTTGCGTTGGCTCAGGATTTATGTTGTGAGATGCTGCGATTGTA TACCCTAACTGGTTGGATTTTAGATAATGCTGGCGGCTTACTTTTCAGTG ATGGCAAGTTGCATCTTCTTTCCTGAAGGAATATTCAATCATAAGCCGCT TTGCTGGGAATCAAAGAATGTTGGATTGGTTCTGTTAGTAACTGTTGCTG TAGTTTAATAACCTGCCCTTGGGAATCAAGCTTGGATCTTGTTGGGATTG TTTTTTATATTATAATTATTAAGAACATATTAACATGTCCTAACAGCTAC ACACAATAGCCCTTTTTATTTTGTTTCTTCTGTTATTGTAAGCACAGTGT GAGATGTTATACCTGTAGTCCTTTTATGTGCTTGTTGCAGCTTGACGATT GTCTATGCCTGGTGAATGTTGATTTCACGAAATTCCTGTTGATAATTTAA TATTAAAGTGTATATTTATTCTTGTATTGTGTTTGGTAGTCATCCGTATG ACGCTGTTTATTAAATTGGTCATTACTACTACAGGTGTTAGCTTGGAAAA TCCAGAGGTTTCATTTGTTCCTTCCCCCTTGGATGGACAATTTTGTGAGC GAGTCCTCCTATCTGGAGTGCCAAGGTTACATCTTGATAGCTATGCAAGC CAAATTCGTGTCAAAATGAATGTCTCTCAGTCGATTCCTGAGAAGTTCCA TTGGAAAATAGAGGTTTGCTTCCATAGGTAAGTCATGTTTTGACTCTTCC CGACTGTAAATGTAGGCATTCTTAGTGTTCGGAAAACTGAAGCAGTTTAC CTTTTGCAGGAATGCCTCCATGGATTTATGCCAGTGCGAGGCTGGTGAAT GGCAAGGTTTTCAAGATGGGATGTGGACTGCTTTAAATTCTCCATATGGA AACAAATATGTTGATGTGAAATTGGCTGATAAGAAACCTGCTAGGTTCAC TCTTTCCATTCAGGAAGGTCAGGATTGTTCATGAAATCAATTCCTTTTTC TTTTCAGTAATAAACTAGGAGCATCGATTTTTATTCTATATAAATCATTT TTTGTTGTTTCAAATACTTATGCAGAGTTTCAGAAATGGCGTTTGGCTTG CCTTGGTATTGGATTTGTATTGCTATTCCTCTCACCAATTGTTAGCAAAT GGGCTCCCTTTTACTATAGCAGCTCTATGGCTCTTGGGATCCTGTTTGTT GTTCTTATTGTACTTTTTCAGGTATATTTTTCCTCAAAAACATTTATATC TTTCTGTAGTAAGGATTTGTTTCCATTGAAACTTGCAACTAGATCATTTC ATAAAAAAATGTTATGTAGTACTTTATTGCCAGAGAGATATTGTCATAAC AGTGTGTTAGACTGTTAGCCGCTTGACGGACCTTACTCAAGAAGCGTTTG AAGTTTTTTTTTTTTAACTTGAGGTCTTGGAAAGAACATGGCTTGTTGTC TTAATAGACTTAGTACCTGCTTGACATGACTGGATGGAAAGATAAAATAA ACATGTTGTGTGTTATTGTTTATCTCTTTTTTTTGTAGGAGTATTGTTTC TTTTATGATCCTGATATTGACCTGAGCCCTTTCATGCTATCCAGTTTTTT TCCCCTTGAACAAATACTGTCCAGTTATTTAGAAGTCCACTTTGTACCGT TGCCCATAATCATCTGAATACATGTGAATCAGATTCATGCTTTCGAATAT CATCATTTGGAATATCAGCAGTGACCAGACAGTTTCACTGTTTTTTGTTA CTAATTGGTACTGAACTTGATATAATGTCTACACCTTTTTCTCAAGAAAT TTTCTGACTACTAGTTTATAGTGATCTTGTAGTGTTAGTATTTTGATTCA TTTATAATTTTCTCCTTAGATAGATTTGGAACATGTAGTGTTCAGGTTGG CTAAACCAATAGTGCCGTGTTATTTTCAAATTTTCTGACAAAAAGAACTG CAAATTTCTACTTCCTTTATATTTGTTGATGATGGTCCATGTTTCCTACG ATAACAATATTGATGTCTGACATTGCCTTCATTTTAGGGGATGAAATTGC TACCAATGGGCAGGAAAAGTTTATTTTACCTTGCAATTTATGGATCTGTG GTAATTACCTTGTACCCACACCATTTTGCAGCTATTTGAATAGGCACTTC TCACTAATTATTTGTACTCATTCATTTTCATTTTCTTTTTACGGACATTT AGTTAGGTGTTGGTTCCTATGTTGTACACTACTTCTCAACATTGGTCTCT TCTATTCTCGAAAACTTCGGCTTGAGTGAAGAGTTGTACAACCCTGTAAG TAATTCCTCTTGCATGTTTTCTAATAATAAATCAACTAACTATTTTTACT CATTTCCCATTTTTGCTTGCACAATATTATTTACTGTTTTCTTTTGTATT CTGGATTTCGGTTTTCTAATGTTTGTTACATCAGAAATGGAGCACACCAG TTTATTTAGTAGTGCTAGTATCACCATTATGTGGCTTTGGAAAGAATTAT AGAAACTAGAGCATGTGTATCAAGTTGGAAGGGGGTTTTTGTTGGTTCTG AATTTTATTTTTGGGCCTGATCTCAGTAACTAGGAAGGGCAGACCTAGTG CAGTTGGTGAGTGCTAGCTCGCCGAGTCACCAGGTCCTGGGTTCGAAGCC GTCTCTCTGCAGAATTTCTGCGGGGGTAAGACTTTGCTTCGGTTATTCCC TTCCCCAGACCCCACTCGTGTGGGAGCCTCTGGCACTGGGTCTGCCTGAT CTCAGTAACTGATAGCCTGAACCCTGAATTTATTACTTATAGACAGAATC AATACACCCAATTGTTCATTATAAACATAGCCTTTGGGAGCTAAATTAAT CTATATCCTGCTAATGTTTTACGTTTACCAAGATGCACATTACACCTGCC TCAGTTTTTGTTGTTATGATTGGAACGTAGTCTGCAATGATAACTTGTTT ATTTCTGATTTCTGACTTACCAAGATGAACATGATACCTGCCTCTGTTTT TGTCATTATGATTGGAATGTAGTCTGCAAAGATAACTTATGTATTTTTTA CTCCTGACTTTAACCAATTATTATCTGGATACTTTGATGTTGTTGTGATT TGTAAGAAATGATGTCAGATAAGTGTAAATGATATGGAAGTTAATAGTGT ATTAAATGCATTGCTACATGGCGGTATGGTTACTTCAAACATCAGAAGTT TTTTTTCTTTTAATGAAGTTTGAAACTTTGACTTATGTAGCTTACAAGAG AATAATCCCAGATCTACTGCCCCGTTGATCTATTTGGTGCACTGTGGTAA AATAAATAATGGTTGAGTTTTTTATTTTTGTTTGGTATTTGCCTTCTATA TAAAACCTAACTGATGAGCAAAAACATAGTGTGCTGCATATAGAGTTCCA TGCTTTTATATGAGACCATGCCTGCTGGGCCATAACTCATAATTGGCACA TAATCACCTTAAAGACTGCACACTTATGGTTCACCATACGCATTTTTTTT TATCTTTTGCTATTGCTTGGAACACTGGACGTTTCTCTGCAATTCTCTGA TATGGTATAATGGAACACTTATGGTTCACCATACACAGTTTGTTACACTT GTTGATCTGTGTGGTATAATGGACTATTCATTACTTGTTTAAGTACATCA GTCTGTTACATAGTTACCTTTACCTGTTATACAAGTCTTTAAGTAACAAA AATTAATGATGAATTACAGGTTTCTATCTTCCTGCTGGTGGCAATTGTCT TCACTGGAGCTGGTTTTGGCTATTGGATGGTCAGGAGATTTATCCTTTCA AAAGATGGAAGTGTAGATGCTGGGATAGCGCAATTTGTAAAGTGGGCTAT GCGTGTTGTTGCTACATTATTCATTATGCAGGTGTGGTTCTATCTTGTTT TCCCTTACCATGTTAAGTATTCTTCTCAAGAACCTGTCTAGTTTGTATCT TGTCCCATGCTTTGGATAAGGTTGCAGTTAACTGCTTTGAATTTCGTATC TGACATGCTGTTTATCTTTCCAGAGCACACTTGATCCTCTTCTAGCACTG GTTTCTCTTGCTTTTAGCTGGTGGTTATGCTCTTTGTTGACTGCAAAGAA AGTTCAGAAGACAATGACCCAGTTAGTACCTCAAGTTAGTTGTCATTGAT GTTGTCTTTGTACCTGTTGAAGTACTGAGTATGCTAGTTCTTCTGCAGGA AACAAAAGCAGTCAATGGTTCTTTCTCACCAAATGCTTACTCAAGGATTG CCCAAGAGTCCTAAAATCCAGTTCTTAAGTCCATCTAAGATAGGCTTTGG AAGAACCACATCTAGAAGTTCCGCCACACAGTACGGTCGGAGCAATTTGG CAAATGGAGGTAATATAACTAGTATTGTTTGCAACTTGAAAGTTTTCTGT TGGCTTGTAGTCAGCATTCTTTATACGATACTGTTAAACAACGTTCACAT GTTAGAAGTTGTGTTTTCATTCATTTGAGCTAATGACAGGACATTTCCAT ACAATTTTTTGATTGAACTATTTTATTTGAACACATTGTAGTGTTTGACT TGACTAGACACTGGGTTTCGCAGGTCTGGTCTGCTCAGCACTTACAAAGC ACGTAGTACCCAACGAAGATGACGAAGATCACTACTCTACCTTCCACAAC ATCCAGCCACGGAAATATTCCAAGGAGGAATGGGAGGACTTCACCCAGAA ATCGACTAGGAAGGCACTTGCGGAGTGCACAGCAACCCCGGAGTTTGCCC AATGGGTCGCTGACAATGCTCATCGTTTGCAAGTAGAGAAAGAGGAAGAC AACTTCTCAGAGGAAGAGACCATCGAGAGCTCCAACTCCTCGGAAGAAAC TGGGGACGAAGCTGATGGAGCTCCAGGTCTGATCAGGCTGTGGGGCTAGC ATGCTGGTTGAACTAAGCATGCTCCTGCCATTTCACGTGTAAAGAGTAGC AAGCGCCCATTTTAACTAGTTTAGCAGCAGGGTAGGGTGGTAGCAGTTGA TTGTTTCCAGTTATTGCCACGGTAGGTTCGTTCTGTCCGGTGGCAGTAGT TGGCTAGCCATCTCAGGTCAATTGATGCTAGGTTTAGCTAGCTTGGTTAT CAGTGGATTCTTAGTTCTTTAGAGCTGATAGGTGAAATGGTTTAAACAGT CTAATTTATGATTGGAATCCAGCATTGTGCTGATTCAGTTGGAAATTTGA AGTTGGGTCATTAGGCATTTCTTGGTGCTCCATTTGGATGGATGGACTCA TGGACAGCATGTGTGTAGAGTGGGTCCCTCGCTTCGCT
back to top

Coding sequence (CDS) from alignment at Sh_009J10:110320..115957+

>Sh_009J10_t000080 ID=Sh_009J10_t000080|Name=Sh_009J10_t000080|organism=R570 Sugarcane cultivar|type=CDS|length=1593bp|location=Sequence derived from alignment at Sh_009J10:110320..115957+ (R570 Sugarcane cultivar)
ATGGCCCCCTCCGCCAGCGAAGCCACCTCGTCGTCGGCGACCAGTGCCAC
CTCGTCCTCGGACGCCGACGCCCCGGCCTCCCCCTCGCCGTCCCCGTCCC
GGCGCGCGGTGCCCACTCTGCTCCTCGTCTCCTTCTTCGCCGCGCTCCTC
GTCCTCTCCTCCGGCGACGATGCCACGGCGCAGCCGCTCAACGGTGTTAG
CTTGGAAAATCCAGAGGTTTCATTTGTTCCTTCCCCCTTGGATGGACAAT
TTTGTGAGCGAGTCCTCCTATCTGGAGTGCCAAGGTTACATCTTGATAGC
TATGCAAGCCAAATTCGTGTCAAAATGAATGTCTCTCAGTCGATTCCTGA
GAAGTTCCATTGGAAAATAGAGGTTTGCTTCCATAGGAATGCCTCCATGG
ATTTATGCCAGTGCGAGGCTGGTGAATGGCAAGGTTTTCAAGATGGGATG
TGGACTGCTTTAAATTCTCCATATGGAAACAAATATGTTGATGTGAAATT
GGCTGATAAGAAACCTGCTAGGTTCACTCTTTCCATTCAGGAAGAGTTTC
AGAAATGGCGTTTGGCTTGCCTTGGTATTGGATTTGTATTGCTATTCCTC
TCACCAATTGTTAGCAAATGGGCTCCCTTTTACTATAGCAGCTCTATGGC
TCTTGGGATCCTGTTTGTTGTTCTTATTGTACTTTTTCAGGGGATGAAAT
TGCTACCAATGGGCAGGAAAAGTTTATTTTACCTTGCAATTTATGGATCT
GTGTTAGGTGTTGGTTCCTATGTTGTACACTACTTCTCAACATTGGTCTC
TTCTATTCTCGAAAACTTCGGCTTGAGTGAAGAGTTGTACAACCCTGTTT
CTATCTTCCTGCTGGTGGCAATTGTCTTCACTGGAGCTGGTTTTGGCTAT
TGGATGGTCAGGAGATTTATCCTTTCAAAAGATGGAAGTGTAGATGCTGG
GATAGCGCAATTTGTAAAGTGGGCTATGCGTGTTGTTGCTACATTATTCA
TTATGCAGAGCACACTTGATCCTCTTCTAGCACTGGTTTCTCTTGCTTTT
AGCTGGTGGTTATGCTCTTTGTTGACTGCAAAGAAAGTTCAGAAGACAAT
GACCCAGAAACAAAAGCAGTCAATGGTTCTTTCTCACCAAATGCTTACTC
AAGGATTGCCCAAGAGTCCTAAAATCCAGTTCTTAAGTCCATCTAAGATA
GGCTTTGGAAGAACCACATCTAGAAGTTCCGCCACACAGTACGGTCGGAG
CAATTTGGCAAATGGAGGTCTGGTCTGCTCAGCACTTACAAAGCACGTAG
TACCCAACGAAGATGACGAAGATCACTACTCTACCTTCCACAACATCCAG
CCACGGAAATATTCCAAGGAGGAATGGGAGGACTTCACCCAGAAATCGAC
TAGGAAGGCACTTGCGGAGTGCACAGCAACCCCGGAGTTTGCCCAATGGG
TCGCTGACAATGCTCATCGTTTGCAAGTAGAGAAAGAGGAAGACAACTTC
TCAGAGGAAGAGACCATCGAGAGCTCCAACTCCTCGGAAGAAACTGGGGA
CGAAGCTGATGGAGCTCCAGGTCTGATCAGGCTGTGGGGCTAG
back to top