Sh_011C13_p000080

Overview
NameSh_011C13_p000080
Unique NameSh_011C13_p000080
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length402
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_011C13contigSh_011C13:121448..122653
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR011009
InterProIPR000719
InterProIPR017441
InterProIPR008271
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_011C13_t000080Sh_011C13_t000080R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_011C13_p000080 ID=Sh_011C13_p000080|Name=Sh_011C13_p000080|organism=R570 Sugarcane cultivar|type=polypeptide|length=402bp
MVTVTTAASCYCWAIKKRELGRKRAELFRKNGGLLLQQRFSTIASQGEDQ
YSAKIFSAEELKAATDNYSESRILGQGGHGTVYKGILPDQTIVAIKKSKV
FDESQVEQFVNEIAILSQIDHPNVVKLLGCCLETQVPLLVYEFIPNGTLL
QHIHNRNATRPLTWEDCLRIAAETADALAYLHSTSSVPIIHRDIKSSNIL
LDENFVAKIADFGASRSVPFDQTHITTLIQGTIGYLDPEYFQTSQLTEKS
DVYSFGVVLAELLTRQKPISAARPEESCNLAMHLVVLFNEGRLLQEIEPH
ILAEAGRDQCYAVAELSVRCLNMKGEERPAMVMVASVLHGLRRSFTIDQT
AARKDESVRKNSEQEEKYLHESIPIPSLQSSEVSTQCSMEAEMLSSSRMP
R*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation