Sh_011C22_p000040

Overview
NameSh_011C22_p000040
Unique NameSh_011C22_p000040
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length565
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_011C22contigSh_011C22:108470..110415
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR004680
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_011C22_t000040Sh_011C22_t000040R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_011C22_p000040 ID=Sh_011C22_p000040|Name=Sh_011C22_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=565bp
MTLASTDKVVLGCIAFTIFWVLAVFPSVPFMPVGRTAGSLLGAMLMVLFR
VMTPEEAYKAIDLPILGLLFGTMVVSIFLERADMFKYLGSALAWRSRGSK
DLLFRVCLVSAVASALFTNDTCCVVLTEFILKLARQNNLPPQPFLLALAS
SSNIGSSATPIGNPQNLVIAVQSGITFGQFLVGVFPAMIVGVVTNTCILL
CYFWRYLSVPEKDQEGGAAERGPEVVADEEVTSHRFTPARMSHASSVNGG
LGVDADCVSEPIRRTDSLNRADTLSMRSRSYNSEGDIQVAIRSMRASSMS
QEMVEVSTVCDRRDDGGGVGPRKITRTTSHQRSVIIEDAPEADADDGQKG
KDGTDVKEKRWKVLVWKSAVYLTTLGMLVALLMGLNMSWSAITAALVLLA
LDFTDAQACLEKVSYSLLIFFCGMFITVDGFNRTGIPNALWELVEPHSRI
DSAKGTALLAVVILVLSNVASNVPTVLLLGSRVAASAAAISPESQKKAWL
ILAWVSTVAGNLTLLGSAANLIVCEQARRAQFFGYNLTFWSHLRFGLPST
IIITAIGLLIVASY*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane