Sh_011E13_contig-1_p000010

Overview
NameSh_011E13_contig-1_p000010
Unique NameSh_011E13_contig-1_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length683
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_011E13_contig-1contigSh_011E13_contig-1:25784..29563
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR001471
InterProIPR016177
InterProIPR031112
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_011E13_contig-1_t000010Sh_011E13_contig-1_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_011E13_contig-1_p000010 ID=Sh_011E13_contig-1_p000010|Name=Sh_011E13_contig-1_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=683bp
MATVNNWLAFSLSPQELPPTQTDSTLISTATTDDVSGDVCFNIPQDWSMR
GSELSALVPEPKLEDFLGGISFSEQHHKANCNMIPSTSSTACYASSGATT
GYHHQLYHQPTSSALHFADSIMVASSAGVHDGAAMLSTATANGGAGAASA
NGGGSIGLSMIKNWLRSQPAPMQPRMAAAEGVQGLSLSMTMAGTTQGAAG
MPLLAGQRGRGPESVSTSAQSGAVVTAPKEDSGGSGVAGAGALVAVSTDT
GGSGGASADNTARKTVDTFGQRTSIYRGVTRHRWTGRYEAHLWDNSCRRE
GQTRKGRQGGYDKEEKAARAYDLAALKYWGPTTTTNFPVSNYEKELEDMK
HMTRQEFVASLRRHHQHGRWQARIGRVAGNKDLYLGTFSTQEEAAEAYDI
AAIKFRGLNAVTNFDMSRYDVKSILDSSALPIGSAAKRLKEAEAAASAQH
HAGVVSYDVGRMASQLGDGGALAAAYGAHYHGAWPTIAFQPSAATGLYHP
YAQPMRGWCKQEQDHAVIAAAHSLQELHHLNLGAAGAHDFFSTGQQAAMH
GLGSMDNASLEHSTGSNSVVYNGVGDSNGSTVVGGGGYMMPMSAAAATAT
TAMVSQEQVHARAQGDHDEAKQAAQMGYESYLVNAENYGGGRMSAAWATV
SAPPVVAVASSNDNMADVGHGDAQLFSVWNDT*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0007275multicellular organism development