Sh_011E13_contig-1_p000070

Overview
NameSh_011E13_contig-1_p000070
Unique NameSh_011E13_contig-1_p000070
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length621
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_011E13_contig-1contigSh_011E13_contig-1:50111..53315
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR029063
InterProIPR004159
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_011E13_contig-1_t000070Sh_011E13_contig-1_t000070R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_011E13_contig-1_p000070 ID=Sh_011E13_contig-1_p000070|Name=Sh_011E13_contig-1_p000070|organism=R570 Sugarcane cultivar|type=polypeptide|length=621bp
MPLSVPSTPAVLAALPRALSLAAAAVAAATASLLLISAVVSNSHHAASSS
SPQLPPSASASTAALAPAPAPDHPGPDHHPHPPPPPVPPCPPNATHDVPC
HEPPSGERHCPPRPPPPPPPHHPPKDPPPHPPPPPPHCRVPPPPGYGPPP
PWPARRDRARYANVDLPSPPPVKVVAGQDPVRRRGEWLVFTEGVRDYVEQ
LERVVPLRGGVVRTALDIGCGVASFGDYLLNYGVLTMSIAPRNNRLGPQV
QLALERGLPAMIGALVAQRLPYPSRSFDMVHCADCPVPWTAHDGLYMLEI
DRLLQPGGYWVFSRPPVDWKSAYNISNQGTRDVQDNQLAMDDMSNKLRWT
KVYEGGTISVWRKPSCHLHCDQEANAKLFGLPPLCTGEDPDSAWYANISM
CMTCIPRAEPFNGCAGGAMEKWPERLGAVPPRIASGEMKWLSIQRYKHDT
LIWEKRVNFYLTYLKYLSNGTYRNVMDMSAGFGGFAASMSKHPVWVMNVV
PANTTENTLGVIYERGLIGTYTDWCEAFSTYPRTYDLIHGNGIFSSHIHK
CGIIDILVEMDRILRPGGAVIVRDIADVVLKVKKDADRLQWHSRIVDTEN
GPLDPEKLLIVDNSLPLPGS*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0008168methyltransferase activity