Sh_011E13_contig-1_t000040

Overview
NameSh_011E13_contig-1_t000040
Unique NameSh_011E13_contig-1_t000040
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1530
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_011E13_contig-1contigSh_011E13_contig-1:41951..45389
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
Notesimilar to Streptococcal hemagglutinin-like protein
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_011E13_contig-1_g000040Sh_011E13_contig-1_g000040R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_011E13_contig-1_p000040Sh_011E13_contig-1_p000040R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_011E13_contig-1_t000040 ID=Sh_011E13_contig-1_t000040|Name=Sh_011E13_contig-1_t000040|organism=R570 Sugarcane cultivar|type=mRNA|length=1530bp
ATGGCCGCCGCCACAGCCCCGCCGTCGCAGAGCGCGGACCTGATGCCGCC
GCCGCCGCCCCCTCCGCCCGTCCCGCCGCCGACTGCGCCCCGTCCGCGCC
GCCGCGCAAGGGAAGTCAGCTCCCGGTACCTCTCAACGCCAGTCCCCTCG
ACCCCGCGCCTCTCTACCGCCTCCGCGGCCTCCTCCACGCGGTCGCGCTC
CCCGACGCCGTCGCCTCGTGGACGGCAGCGGGCGGCCACGCCCTTCGCCA
ACGAGAACCACCCGCCCCCGCCGCCGCCGCCCACGGGCACCGTCGCGCGC
CGGCGGGCTGTCCAGAAGCTTTTCGAGGAAACCGGGGCCGGCAATCTGCG
CGCATCGGTGGGCTCCAACTCCTCCGCCGTGTCCGCAGCTACTCCGCGGC
AGCTCCCGCGCTCCACCAGCGGGCCGGCCGCGCCCACCGCGCGGAGGGGG
TACCCGCGCCTTCCGACGCCCGCGCGTGCTGGCTCCTGCCCAGCCTCCGC
CGCGGTGGAATCCGACACCGCCTCTTGCTGCTCTTCGTCTGATACGTCGT
CCACGGCCACTGACTTGTCTGAGGCCGATCGGGCGCTCGGGATGGCCCCA
GCCTTGTCGTGCGAGAGCCCGCCGCTGCTCGGCCCAGCGTCCTGCCGCGG
GGGACGCCTCTCGTCAGAGCTCCGCTCGTCGGTGCCGGAGTCGGGCGGGT
CCTCGCGGGCGTCCAACCCACTGTGCTACCGCTCGCTCAACTCGGCACTG
TCGATCTCAACGGCGATGGCTGGGAAGCTGACGGCGGCAGGGAGGCCACC
ACAGCCGCAAGGGCCGAAGGCAGCTGATCTGAAGAGGACGGCCATCGTGG
GGGGCAGGAAGGTCGCGGGGAAGCAGGAAGACGTGCATCAGCTGCGGCTG
ATGGACAATTCGTACCTCCAGTACAGGTTCCTCAACGCCCGGGCTGAGGC
AGCAGGCAAGGCCAAGGCGGCGGCTGCAGAGAAATCCTTGTACGGGCTCG
AGGAGAGGATTGCCAGCCTCAGGGTATCTGTTGCTGAGAAGAGGGCAGAG
ATGGAGAGGATGAAAAGGGAGCATACATTGAGTTCAGTAGTAAATGCGCA
GGTGAAGCTCTTGAAAGCTTATGTGTATTGTGACACTGAGATTCTTTGTA
TCAAAGTGCCATATTTGATTCAGTGGGGTGAGATTGAGGGGGGTCATGCA
AGCTGCCTTAGAGGGGCAACAACAGCACTGTCTAACGCCTCGTTACGGCT
ACCAATCATTGGGAGTGTAAATGCCAACTGCGAGGAACTTACAGAAGTCC
TTAAGTCAGCAGCACAACTACTTGAACCGCTTTCACCTTGCATCGAAAAT
TTCCTGCCAAAGGTTGAACAAATCGACGATGTGGCCTCCAATCTGGCCCA
GGTTATCGCTACTGAGAGAACCTTGATAGAGGAGTGCGGTAATCTCCTAT
ACCAAGCACAGAACCTGCAGATGAGGGAGTCCAGCTTGAGGAGCCAAGTG
ATGCAACTGAAACAAAATGAAGCAAAGTAA
back to top

protein sequence of Sh_011E13_contig-1_p000040

>Sh_011E13_contig-1_p000040 ID=Sh_011E13_contig-1_p000040|Name=Sh_011E13_contig-1_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=510bp
MAAATAPPSQSADLMPPPPPPPPVPPPTAPRPRRRAREVSSRYLSTPVPS
TPRLSTASAASSTRSRSPTPSPRGRQRAATPFANENHPPPPPPPTGTVAR
RRAVQKLFEETGAGNLRASVGSNSSAVSAATPRQLPRSTSGPAAPTARRG
YPRLPTPARAGSCPASAAVESDTASCCSSSDTSSTATDLSEADRALGMAP
ALSCESPPLLGPASCRGGRLSSELRSSVPESGGSSRASNPLCYRSLNSAL
SISTAMAGKLTAAGRPPQPQGPKAADLKRTAIVGGRKVAGKQEDVHQLRL
MDNSYLQYRFLNARAEAAGKAKAAAAEKSLYGLEERIASLRVSVAEKRAE
MERMKREHTLSSVVNAQVKLLKAYVYCDTEILCIKVPYLIQWGEIEGGHA
SCLRGATTALSNASLRLPIIGSVNANCEELTEVLKSAAQLLEPLSPCIEN
FLPKVEQIDDVASNLAQVIATERTLIEECGNLLYQAQNLQMRESSLRSQV
MQLKQNEAK*
back to top

mRNA from alignment at Sh_011E13_contig-1:41951..45389+

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_011E13_contig-1_t000040 ID=Sh_011E13_contig-1_t000040|Name=Sh_011E13_contig-1_t000040|organism=R570 Sugarcane cultivar|type=mRNA|length=3439bp|location=Sequence derived from alignment at Sh_011E13_contig-1:41951..45389+ (R570 Sugarcane cultivar)
ATGGCCGCCGCCACAGCCCCGCCGTCGCAGAGCGCGGACCTGATGCCGCC GCCGCCGCCCCCTCCGCCCGTCCCGCCGCCGACTGCGCCCCGTCCGCGCC GCCGCGCAAGGGAAGTCAGCTCCCGGTACCTCTCAACGCCAGTCCCCTCG ACCCCGCGCCTCTCTACCGCCTCCGCGGCCTCCTCCACGCGGTCGCGCTC CCCGACGCCGTCGCCTCGTGGACGGCAGCGGGCGGCCACGCCCTTCGCCA ACGAGAACCACCCGCCCCCGCCGCCGCCGCCCACGGGCACCGTCGCGCGC CGGCGGGCTGTCCAGAAGCTTTTCGAGGAAACCGGGGCCGGCAATCTGCG CGCATCGGTGGGCTCCAACTCCTCCGCCGTGTCCGCAGCTACTCCGCGGC AGCTCCCGCGCTCCACCAGCGGGCCGGCCGCGCCCACCGCGCGGAGGGGG TACCCGCGCCTTCCGACGCCCGCGCGTGCTGGCTCCTGCCCAGCCTCCGC CGCGGTGGAATCCGACACCGCCTCTTGCTGCTCTTCGTCTGATACGTCGT CCACGGCCACTGACTTGTCTGAGGCCGATCGGGCGCTCGGGATGGCCCCA GCCTTGTCGTGCGAGAGCCCGCCGCTGCTCGGCCCAGCGTCCTGCCGCGG GGGACGCCTCTCGTCAGAGCTCCGCTCGTCGGTGCCGGAGTCGGGCGGGT CCTCGCGGGCGTCCAACCCACTGTGCTACCGCTCGCTCAACTCGGCACTG TCGATCTCAACGGCGATGGCTGGGAAGCTGACGGCGGCAGGGAGGCCACC ACAGCCGCAAGGGCCGAAGGCAGCTGATCTGAAGAGGACGGCCATCGTGG GGGGCAGGAAGGTCGCGGGGAAGCAGGAAGACGTGCATCAGCTGCGGCTG ATGGACAATTCGTACCTCCAGTACAGGTTCCTCAACGCCCGGGCTGAGGC AGCAGGCAAGGCCAAGGCGGCGGCTGCAGAGGTGAGGGGCTGTTAATGCA TCGGGCCAGCCGTCAGTGGGGGTGGCTATCTTGTTCTGGTTGATTGATGA AGACATCGAATTTAGGTCCTGACGACGTTTTTTTTTTTGGTGCAAAGAAA TCCTTGTACGGGCTCGAGGAGAGGATTGCCAGCCTCAGGGTATCTGTTGC TGAGAAGAGGGCAGAGATGGAGAGGATGAAAAGGGAGCATACATTGAGTT CAGTAGTAAATGCGCAGGTAAGGCGAAGCTGTGATTTTCTGAATTTTGAA TTGTTGTCGTGTTCAGTGTGCATTTCTTCATAATGGGTGCTAACCAAATT GGTTGATTGTTGATCTAAGCTACCTAAATTCTTCAATCAGATAAATTATA GGGGATGTTGGGTGTCCATTTCATGTCAAGAGAGTTAGACACTGATGTGG GGAACCTCGCTCAGAATCGCTCTTCACTTAAACCAAAAAAGTAGAGACTT TGAAGAATGTCACTAAATGGATATATTTGACTAATATATCAACTGAATTC AGAAGTAGAACAACATTATTTAAATCCAGAATAGAGTTAAGTGTCCAGAA TTAAATCCAGTTTTCCCATTCCGAAGTTTGTTTTTCAAAAAAAAAAAGAA AGAAAAGAAGATATGTACTATACAGTTTGTGTGGTACTCTCCTTTTTTTT GTTGTCTGTATAAAATAGACAGAATATATAGGTGAAGCTCTTCAAAGCAA TGTATGTTTTGATAGTATGAGTTTATTTGTACCAAATCGGGTACCATGCT TTGATTTATATTTGTTTTGTGGGATATATGGTAAAAAGCATGTATATATT GTCAATGTGAATTTTACATGTAACAGAATAGGGTTAGGTATTCAGAATTA AACCATTACATGATTTGTGTGTCACTCTCCTTGTTTGATTTTCTGTATAG AATATACAAAATATATAGGTGAAGCTCTTGAAAGCTTATGTGTATTGTGA CACTGAGATTCTTTGTATCAAAGTGGTTATCATGCTTTGATTTATATTTA TTTGCTTATGATAGGTATATATATATGGTCAATATGAATTTTACATGTAA CACCTTTCTGTCACGTTACTCGAGAACAGATATGTGAAACTTTTAGGTGT CATATTTGATTCACTCTAAAAGAGAGACGTGAAACTTTCAGGTGCCATAT TTGATTCAGTGGGGTGAGATTGAGGGGGGTCATGCAAGCTGCCTTAGAGG GGCAACAACAGCACTGTCTAACGCCTCGTTACGGCTACCAATCATTGGGA GTGTAAATGTAAGACTTCAATACTTCATTAGACATCAGTTCTGTTATTCT GTGCATAAGACCAAATATCATGTTGTTTGATATGCTTGCAGGCCAACTGC GAGGAACTTACAGAAGTCCTTAAGTCAGCAGCACAACTACTTGAACCGCT TTCACCTTGCATCGAAAATTTCCTGCCAAAGGTGAGACTACAGGGATTTT TGAAAAACATATATACCAGAACAGGGTGATGCTTAGCTTTCTTTAGATGC TTCTGGGACATGTTCAATAACTCAAATCATTAAATATATCCATAAATTCA CTGTATCAGATGTAGTTTTCGATGAAATATAGTGAGAATATCTAAACCTT TCAACCTACCACCATATGATTTGCAATTTCTAAGCTATAACTCAAAATCA GATAGGGTGAAGAAAATAGCAAATTTAATGAAATAGAAACTTAGTGCCTA GTGTAGTAGTGTTCCTTTTTAATTCATATACCTATCATCGTTTCTTGCCT TTACTAATGTTGATGAAGTTTGTGTTTAGAAATTTGCAAAGTTTTAGATA GATTCAGTGGTTGTGGTGAATATGGTGTTCTCATTTGATTTGTTGTACTT ATTTATTATGCAACAAAAAAATATCTTGTCATGGAAGTACTTATTTATGC AACAAGAAAATTTATATTGCTATGTAGGTTGAACAAATCGACGATGTGGC CTCCAATCTGGCCCAGGTTATCGCTACTGAGAGAACCTTGATAGAGGAGT GCGGTAATCTCCTATACCAAGCACAGAACCTGCAGGTATGGTTCTAAACT GATAATCATCTCACTTCAGTCAGCATATGCTCTAACTTTGCCACAAAATA TCCAACTGATGCAATGACAAATTCCAATTGCATAGATGAGGGAGTCCAGC TTGAGGAGCCAAGTGATGCAACTGAAACAAAATGAAGCAAAGTAATAGAA GGAAGAGAGGGAAAACACGCCGCTGGGTCGTTTGTTCAACTGAGTGAGCT AACTGTGCTCCACCGTTGGATGTCCAAGAGCCAAGAGGACGGAAGTTGCC TGATCATATATACATCACCAAAGGCATAAGTGGGTTCTACGAATTGCTGA TTCTTTTCCAGTACATACATATGTTATGTAATTTGTTGTGGAAACATTTT TGCTGTCTAGCTATTGGAAAAACAGATAGAAGCATAGTT
back to top

Coding sequence (CDS) from alignment at Sh_011E13_contig-1:41951..45389+

>Sh_011E13_contig-1_t000040 ID=Sh_011E13_contig-1_t000040|Name=Sh_011E13_contig-1_t000040|organism=R570 Sugarcane cultivar|type=CDS|length=1530bp|location=Sequence derived from alignment at Sh_011E13_contig-1:41951..45389+ (R570 Sugarcane cultivar)
ATGGCCGCCGCCACAGCCCCGCCGTCGCAGAGCGCGGACCTGATGCCGCC
GCCGCCGCCCCCTCCGCCCGTCCCGCCGCCGACTGCGCCCCGTCCGCGCC
GCCGCGCAAGGGAAGTCAGCTCCCGGTACCTCTCAACGCCAGTCCCCTCG
ACCCCGCGCCTCTCTACCGCCTCCGCGGCCTCCTCCACGCGGTCGCGCTC
CCCGACGCCGTCGCCTCGTGGACGGCAGCGGGCGGCCACGCCCTTCGCCA
ACGAGAACCACCCGCCCCCGCCGCCGCCGCCCACGGGCACCGTCGCGCGC
CGGCGGGCTGTCCAGAAGCTTTTCGAGGAAACCGGGGCCGGCAATCTGCG
CGCATCGGTGGGCTCCAACTCCTCCGCCGTGTCCGCAGCTACTCCGCGGC
AGCTCCCGCGCTCCACCAGCGGGCCGGCCGCGCCCACCGCGCGGAGGGGG
TACCCGCGCCTTCCGACGCCCGCGCGTGCTGGCTCCTGCCCAGCCTCCGC
CGCGGTGGAATCCGACACCGCCTCTTGCTGCTCTTCGTCTGATACGTCGT
CCACGGCCACTGACTTGTCTGAGGCCGATCGGGCGCTCGGGATGGCCCCA
GCCTTGTCGTGCGAGAGCCCGCCGCTGCTCGGCCCAGCGTCCTGCCGCGG
GGGACGCCTCTCGTCAGAGCTCCGCTCGTCGGTGCCGGAGTCGGGCGGGT
CCTCGCGGGCGTCCAACCCACTGTGCTACCGCTCGCTCAACTCGGCACTG
TCGATCTCAACGGCGATGGCTGGGAAGCTGACGGCGGCAGGGAGGCCACC
ACAGCCGCAAGGGCCGAAGGCAGCTGATCTGAAGAGGACGGCCATCGTGG
GGGGCAGGAAGGTCGCGGGGAAGCAGGAAGACGTGCATCAGCTGCGGCTG
ATGGACAATTCGTACCTCCAGTACAGGTTCCTCAACGCCCGGGCTGAGGC
AGCAGGCAAGGCCAAGGCGGCGGCTGCAGAGAAATCCTTGTACGGGCTCG
AGGAGAGGATTGCCAGCCTCAGGGTATCTGTTGCTGAGAAGAGGGCAGAG
ATGGAGAGGATGAAAAGGGAGCATACATTGAGTTCAGTAGTAAATGCGCA
GGTGAAGCTCTTGAAAGCTTATGTGTATTGTGACACTGAGATTCTTTGTA
TCAAAGTGCCATATTTGATTCAGTGGGGTGAGATTGAGGGGGGTCATGCA
AGCTGCCTTAGAGGGGCAACAACAGCACTGTCTAACGCCTCGTTACGGCT
ACCAATCATTGGGAGTGTAAATGCCAACTGCGAGGAACTTACAGAAGTCC
TTAAGTCAGCAGCACAACTACTTGAACCGCTTTCACCTTGCATCGAAAAT
TTCCTGCCAAAGGTTGAACAAATCGACGATGTGGCCTCCAATCTGGCCCA
GGTTATCGCTACTGAGAGAACCTTGATAGAGGAGTGCGGTAATCTCCTAT
ACCAAGCACAGAACCTGCAGATGAGGGAGTCCAGCTTGAGGAGCCAAGTG
ATGCAACTGAAACAAAATGAAGCAAAGTAA
back to top