Sh_011E13_contig-1_t000050

Overview
NameSh_011E13_contig-1_t000050
Unique NameSh_011E13_contig-1_t000050
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length153
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_011E13_contig-1contigSh_011E13_contig-1:46875..47027
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
Noteweakly similar to Os06g0160600 protein
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_011E13_contig-1_g000050Sh_011E13_contig-1_g000050R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_011E13_contig-1_p000050Sh_011E13_contig-1_p000050R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_011E13_contig-1_t000050 ID=Sh_011E13_contig-1_t000050|Name=Sh_011E13_contig-1_t000050|organism=R570 Sugarcane cultivar|type=mRNA|length=153bp
ATGGAGCACGATTACAGGCTGGACGTCACGGAGCATAACCTCACCGACGT
GATCCACCTCTTCTGCTGGTACTGCTCGCTCTTCTCCACAAAGAAGACCG
CGGCGGCGCCCCCGGACAGCCCGCTGCACATGAACATGGCGAAGCCAGCA
TAG
back to top

protein sequence of Sh_011E13_contig-1_p000050

>Sh_011E13_contig-1_p000050 ID=Sh_011E13_contig-1_p000050|Name=Sh_011E13_contig-1_p000050|organism=R570 Sugarcane cultivar|type=polypeptide|length=51bp
MEHDYRLDVTEHNLTDVIHLFCWYCSLFSTKKTAAAPPDSPLHMNMAKPA
*
back to top

mRNA from alignment at Sh_011E13_contig-1:46875..47027+

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_011E13_contig-1_t000050 ID=Sh_011E13_contig-1_t000050|Name=Sh_011E13_contig-1_t000050|organism=R570 Sugarcane cultivar|type=mRNA|length=153bp|location=Sequence derived from alignment at Sh_011E13_contig-1:46875..47027+ (R570 Sugarcane cultivar)
ATGGAGCACGATTACAGGCTGGACGTCACGGAGCATAACCTCACCGACGT GATCCACCTCTTCTGCTGGTACTGCTCGCTCTTCTCCACAAAGAAGACCG CGGCGGCGCCCCCGGACAGCCCGCTGCACATGAACATGGCGAAGCCAGCA TAG
back to top

Coding sequence (CDS) from alignment at Sh_011E13_contig-1:46875..47027+

>Sh_011E13_contig-1_t000050 ID=Sh_011E13_contig-1_t000050|Name=Sh_011E13_contig-1_t000050|organism=R570 Sugarcane cultivar|type=CDS|length=153bp|location=Sequence derived from alignment at Sh_011E13_contig-1:46875..47027+ (R570 Sugarcane cultivar)
ATGGAGCACGATTACAGGCTGGACGTCACGGAGCATAACCTCACCGACGT
GATCCACCTCTTCTGCTGGTACTGCTCGCTCTTCTCCACAAAGAAGACCG
CGGCGGCGCCCCCGGACAGCCCGCTGCACATGAACATGGCGAAGCCAGCA
TAG
back to top