Sh_011E13_contig-3_p000020

Overview
NameSh_011E13_contig-3_p000020
Unique NameSh_011E13_contig-3_p000020
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length168
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_011E13_contig-3contigSh_011E13_contig-3:5674..7779
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR007271
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_011E13_contig-3_t000020Sh_011E13_contig-3_t000020R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_011E13_contig-3_p000020 ID=Sh_011E13_contig-3_p000020|Name=Sh_011E13_contig-3_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=168bp
MFPALASVYNEKALKSQFDTSIYLQNLFLYGYGAIFNFLGLVITAIIQGP
SSFNILEGHSKATMFLICNNAAQGILSSFFFKYADTILKKYSSTIATIFT
GVASAVLFGHTLTINFVLGISIVIISMHQYLSNQIKDEVPSSKVEMAEAH
DHRRDKDNDSYFRSLMM*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005351sugar:proton symporter activity
Vocabulary: Biological Process
TermDefinition
GO:0008643carbohydrate transport
Vocabulary: Cellular Component
TermDefinition
GO:0000139Golgi membrane
GO:0016021integral component of membrane