Sh_011E13_contig-3_p000030

Overview
NameSh_011E13_contig-3_p000030
Unique NameSh_011E13_contig-3_p000030
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length299
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_011E13_contig-3contigSh_011E13_contig-3:7875..11160
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR007271
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_011E13_contig-3_t000030Sh_011E13_contig-3_t000030R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_011E13_contig-3_p000030 ID=Sh_011E13_contig-3_p000030|Name=Sh_011E13_contig-3_p000030|organism=R570 Sugarcane cultivar|type=polypeptide|length=299bp
MFLKYSKIQGLIWKAKSCRKALHSFVLPEAVAAAGLNGEVECSVCHAKVP
VPPAVSKAYDSHRSTVSSRQRALNVLLVSGDCVLAGLQPILVYMSKVDGK
FKFSPISVNFLTEITKIIFAIVMLFIQARGLKVGDKPLFTVSIFMQAARN
NVLLAVPAFLYAINNYLKFIMQLYFNPASVKMLSNLKWEALALLLIGISV
NQLKSLPEGSSALGLPVAAGAYLYTLFFSVDCSTMLHLHWTLAVVIILIN
SATIPSLRHIVEPLLFDTSRFQASSHSLFSHITDLGSFISFQNNNIHN*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005351sugar:proton symporter activity
Vocabulary: Biological Process
TermDefinition
GO:0008643carbohydrate transport
Vocabulary: Cellular Component
TermDefinition
GO:0000139Golgi membrane
GO:0016021integral component of membrane