Sh_011I19_p000040

Overview
NameSh_011I19_p000040
Unique NameSh_011I19_p000040
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length502
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_011I19contigSh_011I19:28177..30188
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_011I19_t000040Sh_011I19_t000040R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_011I19_p000040 ID=Sh_011I19_p000040|Name=Sh_011I19_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=502bp
MVPLVENSKLNALRDKRSNSTEIWQFIEGLIEDRKKLAAEVSSQIKARLT
ERFAAKEQYKRSKLELETRTRRLEKEKIDLQSNLERELDRRSNDCSVKLE
RFQSEEQRLQERVRELAEQNVSFQREITLLESYKVDATSRIKSLELQNKH
LNNELQEVKDDRDNLHSSSVELQDNLNIAIVERDMIRESLKDKEEDKKVL
HKIIARLQRTSNEQEKTITSLRKGFGAEIEKRAAGNSDIINRMQMELLRL
TGVEQNLRREIQSCTIEMESLRQENVAIFNRLQRSEDGANFSTVRLDQEL
QARVESLQTQGLSLLDDSSQLCAKLLELIKSKKSENSSDVDALVAIEYTL
KYQSMIGGIENVKQSLRMIKSLLTEKQNEEETEQRAEGYLSGQEKLSRDD
IEIKLREEAMTSRVLKEKLLSKELDIEHLQSDLAASVRVQEVLQSEIQRV
QDELCCLTHKYKHLEVQGLKKDEIINQVEAGLPGICKGTDCSSLHAQNSK
R*
back to top