Sh_011I19_p000060

Overview
NameSh_011I19_p000060
Unique NameSh_011I19_p000060
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length245
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_011I19contigSh_011I19:33833..34567
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC2.3.1.181
InterProIPR000544
InterProIPR004143
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_011I19_t000060Sh_011I19_t000060R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_011I19_p000060 ID=Sh_011I19_p000060|Name=Sh_011I19_p000060|organism=R570 Sugarcane cultivar|type=polypeptide|length=245bp
MSGGARRVLEAWRLGVLKYGEALQLQERLVADRKAGRVGDLVLSLQHPPT
YTLGKRREKAERNLLAPEAELRALGAELHRTERGGDVTFHGPRQAVLYPV
LSLRALRLGARRYVEGLESAMIQVAALHGVSARPGDPGETGVWVGDRKIG
AIGVRISSGFTWHGLAFNIDPNLGYFEHIVPCGIAGKGVTSLRREVGDGV
ELPADGVIHDQLVRCLATTLGFTDVEFKDDSERGDLTEAAATQS*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0033819lipoyl(octanoyl) transferase activity
Vocabulary: Biological Process
TermDefinition
GO:0009107lipoate biosynthetic process
GO:0006464cellular protein modification process
Vocabulary: Cellular Component
TermDefinition
GO:0005737cytoplasm