Sh_011I19_p000090

Overview
NameSh_011I19_p000090
Unique NameSh_011I19_p000090
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length142
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_011I19contigSh_011I19:51246..51919
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC3.4.24.53
InterProIPR010666
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_011I19_t000090Sh_011I19_t000090R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_011I19_p000090 ID=Sh_011I19_p000090|Name=Sh_011I19_p000090|organism=R570 Sugarcane cultivar|type=polypeptide|length=142bp
MWTACVAWVNMLALWRASQSSSRSASSSHGGGGGGHGGDYDRQGSPVPYY
IWPLAYEPAVLCKCKAKACRWISWSNGHPGRKFYTCRKARTGDDYGYFLW
ADEEASDWFKELLRDLKDVVWFWKREATNKEGELDAKDMKL*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0008270zinc ion binding