Sh_012A01_p000040

Overview
NameSh_012A01_p000040
Unique NameSh_012A01_p000040
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length350
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_012A01contigSh_012A01:18755..22918
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR005836
InterProIPR029044
InterProIPR005835
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_012A01_t000040Sh_012A01_t000040R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_012A01_p000040 ID=Sh_012A01_p000040|Name=Sh_012A01_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=350bp
MQFALALDANSGPHPIRSCEGGGIDRSEQLSIGGSKQEKALRNRCFGGRV
AATTQCILTSDACPETLHFQTQSSRKSYADANRVSAIILGGGTGSQLFPL
TSTRATPAVPVGGCYRLIDIPMSNCFNSGINKIFVMSQFNSTSLNRHIHR
TYLGGGINFADGSVQVLAATQMPEEPAGWFQGTADSIRKFIWILEDYYNH
KAIEHIVILSGDQLHRMNYMELVQKHVEDNADITMSCAPVDESRASNNGL
VKFDHTGRVLQFFEKPKGADLNSMRVDTNFLSYAIADAQKYPYIASMGIY
VFKKDALLDLLKSKHAQLHDFESEILPRAVVDHSVQVSLICLEYVFFKL*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0008878glucose-1-phosphate adenylyltransferase activity
GO:0016779nucleotidyltransferase activity
Vocabulary: Biological Process
TermDefinition
GO:0005978glycogen biosynthetic process
GO:0009058biosynthetic process